Detailed information
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | VNN48_RS07530 | Genome accession | NZ_CP141723 |
| Coordinates | 1545197..1545502 (+) | Length | 101 a.a. |
| NCBI ID | WP_017368746.1 | Uniprot ID | - |
| Organism | Lactococcus formosensis strain PAQ-208 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1540197..1550502
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VNN48_RS07510 (VNN48_07505) | guaB | 1541305..1542786 (+) | 1482 | WP_003133714.1 | IMP dehydrogenase | - |
| VNN48_RS07515 (VNN48_07510) | rpsU | 1542911..1543087 (+) | 177 | WP_003134539.1 | 30S ribosomal protein S21 | - |
| VNN48_RS07520 (VNN48_07515) | comGA | 1543276..1544220 (+) | 945 | WP_347962685.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| VNN48_RS07525 (VNN48_07520) | comGB | 1544159..1545178 (+) | 1020 | WP_407281527.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| VNN48_RS07530 (VNN48_07525) | comYC | 1545197..1545502 (+) | 306 | WP_017368746.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| VNN48_RS07535 (VNN48_07530) | comGD | 1545477..1545893 (+) | 417 | WP_279365405.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| VNN48_RS07540 (VNN48_07535) | comGE | 1545925..1546158 (+) | 234 | WP_243416060.1 | competence type IV pilus minor pilin ComGE | - |
| VNN48_RS07545 (VNN48_07540) | comGF | 1546145..1546579 (+) | 435 | WP_407281014.1 | competence type IV pilus minor pilin ComGF | - |
| VNN48_RS07550 (VNN48_07545) | - | 1546815..1547660 (+) | 846 | WP_017368750.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| VNN48_RS07555 (VNN48_07550) | - | 1547747..1548616 (-) | 870 | WP_407281016.1 | RluA family pseudouridine synthase | - |
Sequence
Protein
Download Length: 101 a.a. Molecular weight: 11263.19 Da Isoelectric Point: 10.0997
>NTDB_id=918937 VNN48_RS07530 WP_017368746.1 1545197..1545502(+) (comYC) [Lactococcus formosensis strain PAQ-208]
MEKKRFKAFTLIEMLVVLLIISVLLLLFVPNLAKEKKNIQNTGQAAVVKVVEGQAELYQLDKQDGPSLGKLVSGGLITQK
QADSYNDYYTKNPNAKRNVPN
MEKKRFKAFTLIEMLVVLLIISVLLLLFVPNLAKEKKNIQNTGQAAVVKVVEGQAELYQLDKQDGPSLGKLVSGGLITQK
QADSYNDYYTKNPNAKRNVPN
Nucleotide
Download Length: 306 bp
>NTDB_id=918937 VNN48_RS07530 WP_017368746.1 1545197..1545502(+) (comYC) [Lactococcus formosensis strain PAQ-208]
ATGGAAAAAAAGAGGTTCAAAGCTTTTACTTTGATTGAAATGCTTGTCGTCTTACTTATTATCAGTGTTTTACTTTTATT
GTTTGTTCCAAACTTGGCTAAAGAAAAGAAGAATATCCAAAATACGGGTCAAGCAGCAGTTGTTAAAGTTGTCGAAGGGC
AAGCCGAACTTTATCAACTTGATAAACAGGATGGTCCAAGTTTAGGGAAACTTGTCTCCGGTGGGTTAATTACACAGAAG
CAAGCCGATAGCTACAATGATTATTATACTAAGAACCCTAATGCAAAACGTAATGTCCCGAATTAA
ATGGAAAAAAAGAGGTTCAAAGCTTTTACTTTGATTGAAATGCTTGTCGTCTTACTTATTATCAGTGTTTTACTTTTATT
GTTTGTTCCAAACTTGGCTAAAGAAAAGAAGAATATCCAAAATACGGGTCAAGCAGCAGTTGTTAAAGTTGTCGAAGGGC
AAGCCGAACTTTATCAACTTGATAAACAGGATGGTCCAAGTTTAGGGAAACTTGTCTCCGGTGGGTTAATTACACAGAAG
CAAGCCGATAGCTACAATGATTATTATACTAAGAACCCTAATGCAAAACGTAATGTCCCGAATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
62.745 |
100 |
0.634 |
| comYC | Streptococcus mutans UA140 |
66.316 |
94.059 |
0.624 |
| comYC | Streptococcus mutans UA159 |
66.316 |
94.059 |
0.624 |
| comGC/cglC | Streptococcus mitis SK321 |
63.636 |
98.02 |
0.624 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
62 |
99.01 |
0.614 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
59.596 |
98.02 |
0.584 |
| comGC/cglC | Streptococcus pneumoniae D39 |
59.596 |
98.02 |
0.584 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
59.596 |
98.02 |
0.584 |
| comGC/cglC | Streptococcus pneumoniae R6 |
59.596 |
98.02 |
0.584 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
62.637 |
90.099 |
0.564 |
| comYC | Streptococcus suis isolate S10 |
58.025 |
80.198 |
0.465 |
| comGC | Staphylococcus aureus MW2 |
50.633 |
78.218 |
0.396 |
| comGC | Staphylococcus aureus N315 |
50.633 |
78.218 |
0.396 |