Detailed information NTG0892708

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: RYQ61_RS02625
• Genome accession: NZ_CP136799
• Coordinates: 518173..518490 (-)
• Length: 105 a.a.
• NCBI ID: WP_003073983.1
• Uniprot ID: -
• Organism: Streptococcus intermedius strain XH2169
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 513173..523490

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RYQ61_RS02595 (RYQ61_02595)	-	514502..515701 (-)	1200	WP_021003254.1	acetate kinase	-
RYQ61_RS02600 (RYQ61_02600)	comYH	515748..516701 (-)	954	WP_102568323.1	class I SAM-dependent methyltransferase	Machinery gene
RYQ61_RS02605 (RYQ61_02605)	comGG	516792..517118 (-)	327	WP_020999196.1	competence type IV pilus minor pilin ComGG	-
RYQ61_RS02610 (RYQ61_02610)	comGF/cglF	517099..517536 (-)	438	WP_003073990.1	competence type IV pilus minor pilin ComGF	Machinery gene
RYQ61_RS02615 (RYQ61_02615)	comGE/cglE	517520..517813 (-)	294	WP_048785663.1	competence type IV pilus minor pilin ComGE	Machinery gene
RYQ61_RS02620 (RYQ61_02620)	comYD	517785..518213 (-)	429	WP_037582814.1	competence type IV pilus minor pilin ComGD	Machinery gene
RYQ61_RS02625 (RYQ61_02625)	comYC	518173..518490 (-)	318	WP_003073983.1	competence type IV pilus major pilin ComGC	Machinery gene
RYQ61_RS02630 (RYQ61_02630)	comYB	518487..519509 (-)	1023	WP_172964131.1	competence type IV pilus assembly protein ComGB	Machinery gene
RYQ61_RS02635 (RYQ61_02635)	comYA	519451..520392 (-)	942	WP_102568325.1	competence type IV pilus ATPase ComGA	Machinery gene
RYQ61_RS02640 (RYQ61_02640)	-	520461..520826 (-)	366	WP_048785667.1	DUF1033 family protein	-
RYQ61_RS02645 (RYQ61_02645)	glnA	521048..522394 (-)	1347	WP_021003260.1	type I glutamate--ammonia ligase	-
RYQ61_RS02650 (RYQ61_02650)	-	522433..522792 (-)	360	WP_102568326.1	MerR family transcriptional regulator	-
RYQ61_RS02655 (RYQ61_02655)	-	522869..523399 (-)	531	WP_003073971.1	aromatic acid exporter family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11680.80 Da
• Isoelectric Point: 10.1006

>NTDB_id=892708 RYQ61_RS02625 WP_003073983.1 518173..518490(-) (comYC) [Streptococcus intermedius strain XH2169]
MKKIKNLKVKAFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVTEGT
ITDKQAASYKAYYAKHTKETRSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=892708 RYQ61_RS02625 WP_003073983.1 518173..518490(-) (comYC) [Streptococcus intermedius strain XH2169]
GTGAAAAAAATTAAAAATTTGAAGGTTAAAGCTTTTACTTTAGTGGAAATGTTGGTCGTGCTTCTAATCATTAGTGTTTT
AATGCTCTTATTTGTGCCGAATTTGACCAAGCAAAAGGAAGCAGTAACAGAAAAAGGAAATGCAGCTGTGGTCAAAGTTG
TAGAGAGCCAAGCGGAACTTTTTGAGGTCAATCATACCAATGAAAAAGCAACGCTTTCAAAATTAGTCACTGAAGGCACG
ATTACAGATAAGCAGGCAGCGTCATATAAGGCTTACTATGCGAAACATACAAAAGAAACTCGTTCTGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	74.286	100	0.743
comYC	Streptococcus mutans UA140	69.524	100	0.695
comYC	Streptococcus mutans UA159	69.524	100	0.695
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543
comYC	Streptococcus suis isolate S10	64.045	84.762	0.543