Detailed information NTG0885071

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: RMP66_RS00800
• Genome accession: NZ_CP135094
• Coordinates: 127740..128021 (+)
• Length: 93 a.a.
• NCBI ID: WP_011921720.1
• Uniprot ID: A0A0M9FL05
• Organism: Streptococcus suis strain 1547095
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 122740..133021

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMP66_RS00780 (RMP66_00780)	-	124403..124768 (+)	366	WP_002936568.1	DUF1033 family protein	-
RMP66_RS00785 (RMP66_00785)	-	124803..125753 (-)	951	WP_024394700.1	S66 peptidase family protein	-
RMP66_RS00790 (RMP66_00790)	comYA	125839..126789 (+)	951	WP_014637312.1	competence type IV pilus ATPase ComGA	Machinery gene
RMP66_RS00795 (RMP66_00795)	comYB	126701..127738 (+)	1038	WP_043032925.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMP66_RS00800 (RMP66_00800)	comYC	127740..128021 (+)	282	WP_011921720.1	competence type IV pilus major pilin ComGC	Machinery gene
RMP66_RS00805 (RMP66_00805)	comGD	128002..128409 (+)	408	WP_024394702.1	competence type IV pilus minor pilin ComGD	-
RMP66_RS00810 (RMP66_00810)	comYE	128381..128674 (+)	294	WP_024394703.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMP66_RS00815 (RMP66_00815)	comGF/cglF	128661..129095 (+)	435	WP_029750050.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMP66_RS00820 (RMP66_00820)	comGG	129073..129483 (+)	411	WP_024394705.1	competence type IV pilus minor pilin ComGG	-
RMP66_RS00825 (RMP66_00825)	comYH	129540..130493 (+)	954	WP_024394706.1	class I SAM-dependent methyltransferase	Machinery gene
RMP66_RS00830 (RMP66_00830)	-	130543..131730 (+)	1188	WP_014637319.1	acetate kinase	-
RMP66_RS00835 (RMP66_00835)	-	132045..132596 (+)	552	WP_014636756.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10408.34 Da
• Isoelectric Point: 7.0117

>NTDB_id=885071 RMP66_RS00800 WP_011921720.1 127740..128021(+) (comYC) [Streptococcus suis strain 1547095]
MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKKGDAAVVKVVESQMELYELEHDEEATVADLQAKGYI
TEKQAKQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=885071 RMP66_RS00800 WP_011921720.1 127740..128021(+) (comYC) [Streptococcus suis strain 1547095]
ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCT
CTTGCTCCTTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCGGCTGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTATGAATTGGAACATGACGAGGAAGCAACGGTGGCAGATTTGCAGGCGAAAGGTTATATT
ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0M9FL05

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	100	100	1
comGC/cglC	Streptococcus mitis SK321	68.235	91.398	0.624
comGC/cglC	Streptococcus mitis NCTC 12261	68.235	91.398	0.624
comGC/cglC	Streptococcus pneumoniae D39	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae R6	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae TIGR4	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae Rx1	70.37	87.097	0.613
comYC	Streptococcus gordonii str. Challis substr. CH1	61.798	95.699	0.591
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	56.818	94.624	0.538
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398
comGC	Latilactobacillus sakei subsp. sakei 23K	43.75	86.022	0.376