Detailed information NTG0885073

Bioinformatically predicted

Overview

• Name: comGF/cglF
• Type: Machinery gene
• Locus tag: RMP66_RS00815
• Genome accession: NZ_CP135094
• Coordinates: 128661..129095 (+)
• Length: 144 a.a.
• NCBI ID: WP_029750050.1
• Uniprot ID: -
• Organism: Streptococcus suis strain 1547095
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 123661..134095

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMP66_RS00780 (RMP66_00780)	-	124403..124768 (+)	366	WP_002936568.1	DUF1033 family protein	-
RMP66_RS00785 (RMP66_00785)	-	124803..125753 (-)	951	WP_024394700.1	S66 peptidase family protein	-
RMP66_RS00790 (RMP66_00790)	comYA	125839..126789 (+)	951	WP_014637312.1	competence type IV pilus ATPase ComGA	Machinery gene
RMP66_RS00795 (RMP66_00795)	comYB	126701..127738 (+)	1038	WP_043032925.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMP66_RS00800 (RMP66_00800)	comYC	127740..128021 (+)	282	WP_011921720.1	competence type IV pilus major pilin ComGC	Machinery gene
RMP66_RS00805 (RMP66_00805)	comGD	128002..128409 (+)	408	WP_024394702.1	competence type IV pilus minor pilin ComGD	-
RMP66_RS00810 (RMP66_00810)	comYE	128381..128674 (+)	294	WP_024394703.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMP66_RS00815 (RMP66_00815)	comGF/cglF	128661..129095 (+)	435	WP_029750050.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMP66_RS00820 (RMP66_00820)	comGG	129073..129483 (+)	411	WP_024394705.1	competence type IV pilus minor pilin ComGG	-
RMP66_RS00825 (RMP66_00825)	comYH	129540..130493 (+)	954	WP_024394706.1	class I SAM-dependent methyltransferase	Machinery gene
RMP66_RS00830 (RMP66_00830)	-	130543..131730 (+)	1188	WP_014637319.1	acetate kinase	-
RMP66_RS00835 (RMP66_00835)	-	132045..132596 (+)	552	WP_014636756.1	folate family ECF transporter S component	-
RMP66_RS00840 (RMP66_00840)	-	132650..133906 (+)	1257	WP_172005964.1	folylpolyglutamate synthase/dihydrofolate synthase family protein	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16507.85 Da
• Isoelectric Point: 8.8193

>NTDB_id=885073 RMP66_RS00815 WP_029750050.1 128661..129095(+) (comGF/cglF) [Streptococcus suis strain 1547095]
MLKSKIPAFTLLECLVALVILSGSLLVFEGLSKLLIQEAHYQRQSVQKEWLVFSSQLRSEWDRSELVKVENGKVYVDKGG
QSLAFGKSRSDDFRKTNDRGQGYQPMLYQVDSAAISQENQLVRIDFSFKNGEERTFIYAFKEKS

Nucleotide

• Length: 435 bp

>NTDB_id=885073 RMP66_RS00815 WP_029750050.1 128661..129095(+) (comGF/cglF) [Streptococcus suis strain 1547095]
TTGTTAAAAAGTAAAATTCCCGCTTTTACTCTCCTGGAATGCTTGGTAGCCTTAGTCATCCTATCAGGAAGTCTTCTGGT
CTTTGAAGGCTTGTCAAAGTTGTTGATTCAAGAAGCACATTACCAACGTCAATCTGTCCAAAAGGAGTGGCTGGTATTTT
CTAGTCAGTTGCGGTCAGAGTGGGACCGGTCGGAATTGGTCAAGGTTGAAAATGGCAAGGTCTATGTTGATAAAGGTGGT
CAGTCGTTGGCCTTTGGTAAGTCACGATCGGATGATTTTCGGAAAACAAATGACAGGGGACAGGGCTACCAGCCCATGCT
CTATCAGGTGGACAGTGCAGCTATTTCCCAAGAAAACCAGCTGGTGCGTATCGACTTTAGCTTTAAAAACGGAGAGGAGC
GGACCTTTATCTATGCTTTTAAAGAAAAAAGTTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (36-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF/cglF	Streptococcus pneumoniae TIGR4	56.738	97.917	0.556
comGF/cglF	Streptococcus pneumoniae Rx1	56.738	97.917	0.556
comGF/cglF	Streptococcus pneumoniae D39	56.738	97.917	0.556
comGF/cglF	Streptococcus pneumoniae R6	56.738	97.917	0.556
comGF/cglF	Streptococcus mitis NCTC 12261	57.463	93.056	0.535
comGF/cglF	Streptococcus mitis SK321	54.478	93.056	0.507
comYF	Streptococcus mutans UA140	50.694	100	0.507
comYF	Streptococcus mutans UA159	50	100	0.5
comGF	Lactococcus lactis subsp. cremoris KW2	46.099	97.917	0.451