Detailed information NTG0884723

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: RMQ62_RS05015
• Genome accession: NZ_CP135065
• Coordinates: 1054812..1055093 (-)
• Length: 93 a.a.
• NCBI ID: WP_074391328.1
• Uniprot ID: -
• Organism: Streptococcus suis strain ID24665
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1049812..1060093

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMQ62_RS04980 (RMQ62_04980)	-	1050235..1050786 (-)	552	WP_044680793.1	folate family ECF transporter S component	-
RMQ62_RS04985 (RMQ62_04985)	-	1051103..1052290 (-)	1188	WP_044680792.1	acetate kinase	-
RMQ62_RS04990 (RMQ62_04990)	comYH	1052340..1053293 (-)	954	WP_024401509.1	class I SAM-dependent methyltransferase	Machinery gene
RMQ62_RS04995 (RMQ62_04995)	comGG	1053350..1053760 (-)	411	WP_024401508.1	competence type IV pilus minor pilin ComGG	-
RMQ62_RS05000 (RMQ62_05000)	comGF/cglF	1053738..1054172 (-)	435	WP_024389483.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMQ62_RS05005 (RMQ62_05005)	comYE	1054159..1054452 (-)	294	WP_024401507.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMQ62_RS05010 (RMQ62_05010)	comGD	1054424..1054831 (-)	408	WP_074391329.1	competence type IV pilus minor pilin ComGD	-
RMQ62_RS05015 (RMQ62_05015)	comYC	1054812..1055093 (-)	282	WP_074391328.1	competence type IV pilus major pilin ComGC	Machinery gene
RMQ62_RS05020 (RMQ62_05020)	comYB	1055095..1056132 (-)	1038	WP_269472402.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMQ62_RS05025 (RMQ62_05025)	comYA	1056044..1056994 (-)	951	WP_313741731.1	competence type IV pilus ATPase ComGA	Machinery gene
RMQ62_RS05030 (RMQ62_05030)	-	1057080..1058030 (+)	951	WP_313741732.1	LD-carboxypeptidase	-
RMQ62_RS05035 (RMQ62_05035)	-	1058065..1058430 (-)	366	WP_024395451.1	DUF1033 family protein	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10474.48 Da
• Isoelectric Point: 8.3596

>NTDB_id=884723 RMQ62_RS05015 WP_074391328.1 1054812..1055093(-) (comYC) [Streptococcus suis strain ID24665]
MKKLIEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSKQKDAIQKKGDAAVVKVVESQMELYELEYDKEATVEDLQKAGYI
TPKQAEQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=884723 RMQ62_RS05015 WP_074391328.1 1054812..1055093(-) (comYC) [Streptococcus suis strain ID24665]
ATGAAAAAATTAATTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGAATTATCAGCCTGCT
CTTGCTCCTCTTTGTGCCAAATTTGAGCAAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCTGCGGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTATGAATTGGAATATGATAAGGAAGCAACGGTGGAGGACTTGCAAAAGGCTGGTTATATT
ACGCCAAAACAAGCGGAGCAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	90.323	100	0.903
comGC/cglC	Streptococcus pneumoniae Rx1	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae D39	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae R6	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae TIGR4	61.957	98.925	0.613
comGC/cglC	Streptococcus mitis NCTC 12261	61.957	98.925	0.613
comGC/cglC	Streptococcus mitis SK321	61.957	98.925	0.613
comYC	Streptococcus gordonii str. Challis substr. CH1	62.921	95.699	0.602
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	57.955	94.624	0.548
comGC	Staphylococcus aureus MW2	48.718	83.871	0.409
comGC	Staphylococcus aureus N315	48.718	83.871	0.409
comGC	Bacillus subtilis subsp. subtilis str. 168	48	80.645	0.387