NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	V8N34_RS00770	Genome accession	NZ_CP149804
Coordinates	119853..120134 (+)	Length	93 a.a.
NCBI ID	WP_002936550.1	Uniprot ID	-
Organism	Streptococcus suis strain YA
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 114853..125134

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V8N34_RS00750 (V8N34_00750)	-	116516..116881 (+)	366	WP_002936568.1	DUF1033 family protein	-
V8N34_RS00755 (V8N34_00755)	-	116916..117866 (-)	951	WP_014636751.1	S66 peptidase family protein	-
V8N34_RS00760 (V8N34_00760)	comGA	117952..118902 (+)	951	WP_002936562.1	competence type IV pilus ATPase ComGA	Machinery gene
V8N34_RS00765 (V8N34_00765)	comGB	118814..119851 (+)	1038	WP_255195823.1	competence type IV pilus assembly protein ComGB	Machinery gene
V8N34_RS00770 (V8N34_00770)	comGC	119853..120134 (+)	282	WP_002936550.1	competence type IV pilus major pilin ComGC	Machinery gene
V8N34_RS00775 (V8N34_00775)	comGD/cglD	120115..120522 (+)	408	WP_318825439.1	competence type IV pilus minor pilin ComGD	Machinery gene
V8N34_RS00780 (V8N34_00780)	comGE	120494..120787 (+)	294	WP_002936548.1	competence type IV pilus minor pilin ComGE	Machinery gene
V8N34_RS00785 (V8N34_00785)	comGF/cglF	120774..121208 (+)	435	WP_002936547.1	competence type IV pilus minor pilin ComGF	Machinery gene
V8N34_RS00790 (V8N34_00790)	comGG	121186..121596 (+)	411	WP_002936546.1	competence type IV pilus minor pilin ComGG	-
V8N34_RS00795 (V8N34_00795)	comGH	121653..122606 (+)	954	WP_044668119.1	class I SAM-dependent methyltransferase	Machinery gene
V8N34_RS00800 (V8N34_00800)	-	122656..123843 (+)	1188	WP_002936543.1	acetate kinase	-
V8N34_RS00805 (V8N34_00805)	-	124158..124709 (+)	552	WP_014636756.1	folate family ECF transporter S component	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10452.31 Da Isoelectric Point: 5.1667

                                >NTDB_id=875449 V8N34_RS00770 WP_002936550.1 119853..120134(+) (comGC) [Streptococcus suis strain YA]

MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSKQKDAVQEKGNAAVVKVVESQMELYELEHDEEATVEDLQQAGYI

TEKQAKQYATAKK

Nucleotide

Download Length: 282 bp

                                >NTDB_id=875449 V8N34_RS00770 WP_002936550.1 119853..120134(+) (comGC) [Streptococcus suis strain YA]

ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCT

CTTGCTCTTATTTGTGCCAAATTTGAGCAAACAAAAGGATGCTGTTCAAGAGAAAGGAAATGCTGCCGTTGTCAAAGTAG

TGGAGAGTCAGATGGAGCTCTACGAATTGGAACATGACGAGGAAGCAACGGTGGAGGATTTGCAACAGGCAGGTTATATT

ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Streptococcus suis isolate S10	92.473	100	0.925
comGC/cglC	Streptococcus pneumoniae TIGR4	68.182	94.624	0.645
comGC/cglC	Streptococcus pneumoniae Rx1	68.182	94.624	0.645
comGC/cglC	Streptococcus pneumoniae D39	68.182	94.624	0.645
comGC/cglC	Streptococcus pneumoniae R6	68.182	94.624	0.645
comGC/cglC	Streptococcus mitis SK321	69.412	91.398	0.634
comGC/cglC	Streptococcus mitis NCTC 12261	69.412	91.398	0.634
comGC	Streptococcus gordonii str. Challis substr. CH1	65.169	95.699	0.624
comGC	Streptococcus mutans UA140	61.364	94.624	0.581
comGC	Streptococcus mutans UA159	61.364	94.624	0.581
comGC	Lactococcus lactis subsp. cremoris KW2	59.091	94.624	0.559
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	80.645	0.376

Detailed information NTG0875449