Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QQO15_RS10910 | Genome accession | NZ_CP127094 |
| Coordinates | 2249239..2249676 (-) | Length | 145 a.a. |
| NCBI ID | WP_214537933.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain 19KM0990 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2217165..2260165 | 2249239..2249676 | within | 0 |
Gene organization within MGE regions
Location: 2217165..2260165
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO15_RS10680 (QQO15_10680) | clpP | 2217165..2217779 (-) | 615 | WP_256726599.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
| QQO15_RS10690 (QQO15_10690) | - | 2218344..2219099 (-) | 756 | WP_063282656.1 | CHAP domain-containing protein | - |
| QQO15_RS10695 (QQO15_10695) | - | 2219112..2219366 (-) | 255 | WP_063282655.1 | phage holin | - |
| QQO15_RS10700 (QQO15_10700) | - | 2219385..2221274 (-) | 1890 | WP_199569645.1 | glucosaminidase domain-containing protein | - |
| QQO15_RS10705 (QQO15_10705) | - | 2221397..2221771 (-) | 375 | WP_015728845.1 | hypothetical protein | - |
| QQO15_RS10710 (QQO15_10710) | - | 2221804..2223075 (-) | 1272 | WP_037543575.1 | phage baseplate upper protein | - |
| QQO15_RS10715 (QQO15_10715) | - | 2223092..2224135 (-) | 1044 | WP_214537944.1 | SGNH/GDSL hydrolase family protein | - |
| QQO15_RS10720 (QQO15_10720) | - | 2224147..2224839 (-) | 693 | WP_103866906.1 | hypothetical protein | - |
| QQO15_RS10725 (QQO15_10725) | - | 2224843..2226240 (-) | 1398 | WP_110161816.1 | phage tail protein | - |
| QQO15_RS10730 (QQO15_10730) | - | 2226253..2227185 (-) | 933 | WP_015728840.1 | phage tail family protein | - |
| QQO15_RS10735 (QQO15_10735) | - | 2227198..2230317 (-) | 3120 | WP_285238419.1 | phage tail protein | - |
| QQO15_RS10740 (QQO15_10740) | - | 2230334..2230684 (-) | 351 | WP_015728838.1 | hypothetical protein | - |
| QQO15_RS10745 (QQO15_10745) | - | 2230714..2231094 (-) | 381 | WP_015728837.1 | tail assembly chaperone | - |
| QQO15_RS10750 (QQO15_10750) | - | 2231154..2231807 (-) | 654 | WP_285238420.1 | phage major tail protein, TP901-1 family | - |
| QQO15_RS10755 (QQO15_10755) | - | 2231825..2232220 (-) | 396 | WP_015728835.1 | hypothetical protein | - |
| QQO15_RS10760 (QQO15_10760) | - | 2232232..2232582 (-) | 351 | WP_285238421.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QQO15_RS10765 (QQO15_10765) | - | 2232884..2233216 (-) | 333 | WP_015728833.1 | phage head-tail connector protein | - |
| QQO15_RS10770 (QQO15_10770) | - | 2233228..2233677 (-) | 450 | WP_060830214.1 | Ig-like domain-containing protein | - |
| QQO15_RS10775 (QQO15_10775) | - | 2233767..2234678 (-) | 912 | WP_140232575.1 | capsid protein | - |
| QQO15_RS10780 (QQO15_10780) | - | 2234697..2235305 (-) | 609 | WP_041614791.1 | DUF4355 domain-containing protein | - |
| QQO15_RS10785 (QQO15_10785) | - | 2235458..2235652 (-) | 195 | WP_014613564.1 | hypothetical protein | - |
| QQO15_RS10790 (QQO15_10790) | - | 2235649..2237001 (-) | 1353 | WP_140232573.1 | minor capsid protein | - |
| QQO15_RS10795 (QQO15_10795) | - | 2236994..2238439 (-) | 1446 | WP_099997379.1 | phage portal protein | - |
| QQO15_RS10800 (QQO15_10800) | - | 2238451..2239725 (-) | 1275 | WP_037543597.1 | PBSX family phage terminase large subunit | - |
| QQO15_RS10805 (QQO15_10805) | - | 2239712..2240155 (-) | 444 | WP_096536443.1 | terminase small subunit | - |
| QQO15_RS10810 (QQO15_10810) | - | 2240444..2240869 (-) | 426 | WP_037543601.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| QQO15_RS10815 (QQO15_10815) | - | 2240870..2241136 (-) | 267 | WP_041614785.1 | hypothetical protein | - |
| QQO15_RS10820 (QQO15_10820) | - | 2241133..2241282 (-) | 150 | WP_015728822.1 | DUF1381 domain-containing protein | - |
| QQO15_RS10825 (QQO15_10825) | - | 2241279..2241743 (-) | 465 | WP_101458474.1 | class I SAM-dependent methyltransferase | - |
| QQO15_RS10830 (QQO15_10830) | - | 2241755..2242195 (-) | 441 | WP_101485121.1 | hypothetical protein | - |
| QQO15_RS10835 (QQO15_10835) | - | 2242248..2242778 (-) | 531 | WP_285238422.1 | dUTP pyrophosphatase | - |
| QQO15_RS10840 (QQO15_10840) | - | 2242779..2242934 (-) | 156 | WP_202996953.1 | hypothetical protein | - |
| QQO15_RS10845 (QQO15_10845) | - | 2242935..2243414 (-) | 480 | WP_115807088.1 | hypothetical protein | - |
| QQO15_RS10850 (QQO15_10850) | - | 2243608..2243997 (-) | 390 | WP_349357134.1 | hypothetical protein | - |
| QQO15_RS10855 (QQO15_10855) | - | 2243997..2244245 (-) | 249 | WP_103926868.1 | hypothetical protein | - |
| QQO15_RS10860 (QQO15_10860) | - | 2244245..2244742 (-) | 498 | WP_129945892.1 | DUF3310 domain-containing protein | - |
| QQO15_RS10865 (QQO15_10865) | - | 2244899..2245207 (-) | 309 | WP_285238424.1 | hypothetical protein | - |
| QQO15_RS10870 (QQO15_10870) | - | 2245218..2245436 (-) | 219 | WP_096638649.1 | hypothetical protein | - |
| QQO15_RS10875 (QQO15_10875) | - | 2245429..2245851 (-) | 423 | WP_103863100.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QQO15_RS10880 (QQO15_10880) | - | 2245835..2246056 (-) | 222 | WP_096533163.1 | hypothetical protein | - |
| QQO15_RS10885 (QQO15_10885) | - | 2246053..2247297 (-) | 1245 | WP_214537937.1 | DnaB helicase C-terminal domain-containing protein | - |
| QQO15_RS10890 (QQO15_10890) | - | 2247290..2247637 (-) | 348 | WP_214537936.1 | hypothetical protein | - |
| QQO15_RS10895 (QQO15_10895) | - | 2247642..2248388 (-) | 747 | WP_214537935.1 | DnaD domain protein | - |
| QQO15_RS10900 (QQO15_10900) | - | 2248381..2249055 (-) | 675 | WP_214537934.1 | putative HNHc nuclease | - |
| QQO15_RS10905 (QQO15_10905) | - | 2249064..2249258 (-) | 195 | WP_285238425.1 | hypothetical protein | - |
| QQO15_RS10910 (QQO15_10910) | ssbA | 2249239..2249676 (-) | 438 | WP_214537933.1 | single-stranded DNA-binding protein | Machinery gene |
| QQO15_RS10915 (QQO15_10915) | - | 2249676..2250347 (-) | 672 | WP_214537932.1 | ERF family protein | - |
| QQO15_RS10920 (QQO15_10920) | - | 2250344..2250829 (-) | 486 | WP_214537931.1 | siphovirus Gp157 family protein | - |
| QQO15_RS10925 (QQO15_10925) | - | 2250813..2251037 (-) | 225 | WP_096666742.1 | hypothetical protein | - |
| QQO15_RS10930 (QQO15_10930) | - | 2251049..2251309 (-) | 261 | WP_214537930.1 | DUF1108 family protein | - |
| QQO15_RS10935 (QQO15_10935) | - | 2251389..2251574 (-) | 186 | WP_214540360.1 | hypothetical protein | - |
| QQO15_RS10940 (QQO15_10940) | - | 2251567..2251890 (-) | 324 | WP_285238426.1 | DUF771 domain-containing protein | - |
| QQO15_RS10945 (QQO15_10945) | - | 2251958..2252128 (+) | 171 | WP_180902892.1 | hypothetical protein | - |
| QQO15_RS10950 (QQO15_10950) | - | 2252140..2252430 (-) | 291 | WP_140228647.1 | hypothetical protein | - |
| QQO15_RS10955 (QQO15_10955) | - | 2252441..2253196 (-) | 756 | WP_140228648.1 | phage regulatory protein/antirepressor Ant | - |
| QQO15_RS10960 (QQO15_10960) | - | 2253273..2253500 (+) | 228 | WP_214537929.1 | hypothetical protein | - |
| QQO15_RS10965 (QQO15_10965) | - | 2253497..2253661 (-) | 165 | WP_214537928.1 | hypothetical protein | - |
| QQO15_RS10970 (QQO15_10970) | - | 2253699..2254142 (-) | 444 | WP_065354605.1 | hypothetical protein | - |
| QQO15_RS10975 (QQO15_10975) | - | 2254188..2254400 (-) | 213 | WP_000213811.1 | helix-turn-helix transcriptional regulator | - |
| QQO15_RS10980 (QQO15_10980) | - | 2254552..2255274 (+) | 723 | WP_214537927.1 | XRE family transcriptional regulator | - |
| QQO15_RS10985 (QQO15_10985) | - | 2255324..2255833 (+) | 510 | WP_222936263.1 | hypothetical protein | - |
| QQO15_RS10990 (QQO15_10990) | - | 2255881..2256336 (+) | 456 | WP_100004256.1 | hypothetical protein | - |
| QQO15_RS10995 (QQO15_10995) | - | 2256350..2257138 (+) | 789 | WP_100004255.1 | DUF1828 domain-containing protein | - |
| QQO15_RS11000 (QQO15_11000) | - | 2257199..2258236 (+) | 1038 | WP_214537926.1 | site-specific integrase | - |
| QQO15_RS11005 (QQO15_11005) | whiA | 2259221..2260165 (-) | 945 | WP_014614491.1 | DNA-binding protein WhiA | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16408.09 Da Isoelectric Point: 4.9225
>NTDB_id=841638 QQO15_RS10910 WP_214537933.1 2249239..2249676(-) (ssbA) [Staphylococcus pseudintermedius strain 19KM0990]
MLNRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLSKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNPSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
MLNRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLSKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNPSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=841638 QQO15_RS10910 WP_214537933.1 2249239..2249676(-) (ssbA) [Staphylococcus pseudintermedius strain 19KM0990]
ATGCTCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAACGTGAACAACTATCTAAGCAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTTATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCCATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
ATGCTCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAACGTGAACAACTATCTAAGCAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTTATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCCATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.395 |
100 |
0.669 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.593 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
73.103 |
0.414 |
| ssbA | Streptococcus mutans UA159 |
39.31 |
100 |
0.393 |
| ssb | Vibrio cholerae strain A1552 |
31.792 |
100 |
0.379 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.931 |
100 |
0.379 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.931 |
100 |
0.379 |
| ssb | Glaesserella parasuis strain SC1401 |
30.337 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.241 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
31.034 |
100 |
0.372 |