Detailed information NTG0838050

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LL303_RS12280
• Genome accession: NZ_CP126467
• Coordinates: 2384990..2385373 (-)
• Length: 127 a.a.
• NCBI ID: WP_010906318.1
• Uniprot ID: A0A3N6KXZ7
• Organism: Lactococcus lactis subsp. lactis strain 303
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2379990..2390373

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LL303_RS12240 (LL303_12210)	-	2380526..2381335 (-)	810	WP_010906310.1	metal ABC transporter permease	-
LL303_RS12245 (LL303_12215)	-	2381328..2382065 (-)	738	WP_012898617.1	metal ABC transporter ATP-binding protein	-
LL303_RS12250 (LL303_12220)	-	2382242..2383084 (-)	843	WP_015427160.1	metal ABC transporter substrate-binding protein	-
LL303_RS12255 (LL303_12225)	-	2383081..2383518 (-)	438	WP_010906313.1	zinc-dependent MarR family transcriptional regulator	-
LL303_RS12260 (LL303_12230)	comGG	2383599..2383883 (-)	285	WP_010906314.1	competence type IV pilus minor pilin ComGG	Machinery gene
LL303_RS12265 (LL303_12235)	comGF	2383922..2384368 (-)	447	WP_031558968.1	competence type IV pilus minor pilin ComGF	Machinery gene
LL303_RS12270 (LL303_12240)	comGE	2384331..2384627 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LL303_RS12275 (LL303_12245)	comGD	2384599..2384997 (-)	399	WP_023164614.1	competence type IV pilus minor pilin ComGD	Machinery gene
LL303_RS12280 (LL303_12250)	comGC	2384990..2385373 (-)	384	WP_010906318.1	competence type IV pilus major pilin ComGC	Machinery gene
LL303_RS12285 (LL303_12255)	comGB	2385387..2386460 (-)	1074	WP_095348492.1	competence type IV pilus assembly protein ComGB	Machinery gene
LL303_RS12290 (LL303_12260)	comGA	2386354..2387292 (-)	939	WP_031561106.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

• Length: 127 a.a.
• Molecular weight: 14797.39 Da
• Isoelectric Point: 8.4538

>NTDB_id=838050 LL303_RS12280 WP_010906318.1 2384990..2385373(-) (comGC) [Lactococcus lactis subsp. lactis strain 303]
MERTKKFILKKIQKIFLFVKICEKKCRQKELKAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQA
QLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

• Length: 384 bp

>NTDB_id=838050 LL303_RS12280 WP_010906318.1 2384990..2385373(-) (comGC) [Lactococcus lactis subsp. lactis strain 303]
ATGGAAAGAACAAAGAAGTTTATTTTAAAAAAAATACAAAAAATATTTTTATTCGTTAAAATTTGTGAAAAAAAATGCCG
TCAGAAAGAGCTAAAAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTG
TTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTCAAAGTAGTAGAAAGTCAAGCT
CAACTTTATGAATTAGATCATGATGATGAGAAGCCGAGTCTGTCAGAATTGCTCAGTGCAGGGATGATTACTCAAAAACA
AATTTCTGCTTACGATAATTACTATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (32-52)

3D structure

• AlphaFold DB: A0A3N6KXZ7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	81.034	91.339	0.74
comGC/cglC	Streptococcus mitis SK321	56.436	79.528	0.449
comYC	Streptococcus mutans UA159	55.446	79.528	0.441
comYC	Streptococcus mutans UA140	55.446	79.528	0.441
comYC	Streptococcus gordonii str. Challis substr. CH1	56.566	77.953	0.441
comGC/cglC	Streptococcus pneumoniae TIGR4	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae Rx1	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae D39	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae R6	54.455	79.528	0.433
comGC/cglC	Streptococcus mitis NCTC 12261	58.427	70.079	0.409
comYC	Streptococcus suis isolate S10	56.818	69.291	0.394