Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LL303_RS12260 Genome accession   NZ_CP126467
Coordinates   2383599..2383883 (-) Length   94 a.a.
NCBI ID   WP_010906314.1    Uniprot ID   A0AAC9R304
Organism   Lactococcus lactis subsp. lactis strain 303     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2378599..2388883
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LL303_RS12230 (LL303_12200) - 2379039..2379416 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LL303_RS12235 (LL303_12205) - 2379621..2380487 (+) 867 WP_010906309.1 RluA family pseudouridine synthase -
  LL303_RS12240 (LL303_12210) - 2380526..2381335 (-) 810 WP_010906310.1 metal ABC transporter permease -
  LL303_RS12245 (LL303_12215) - 2381328..2382065 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LL303_RS12250 (LL303_12220) - 2382242..2383084 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  LL303_RS12255 (LL303_12225) - 2383081..2383518 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  LL303_RS12260 (LL303_12230) comGG 2383599..2383883 (-) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  LL303_RS12265 (LL303_12235) comGF 2383922..2384368 (-) 447 WP_031558968.1 competence type IV pilus minor pilin ComGF Machinery gene
  LL303_RS12270 (LL303_12240) comGE 2384331..2384627 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LL303_RS12275 (LL303_12245) comGD 2384599..2384997 (-) 399 WP_023164614.1 competence type IV pilus minor pilin ComGD Machinery gene
  LL303_RS12280 (LL303_12250) comGC 2384990..2385373 (-) 384 WP_010906318.1 competence type IV pilus major pilin ComGC Machinery gene
  LL303_RS12285 (LL303_12255) comGB 2385387..2386460 (-) 1074 WP_095348492.1 competence type IV pilus assembly protein ComGB Machinery gene
  LL303_RS12290 (LL303_12260) comGA 2386354..2387292 (-) 939 WP_031561106.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=838046 LL303_RS12260 WP_010906314.1 2383599..2383883(-) (comGG) [Lactococcus lactis subsp. lactis strain 303]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=838046 LL303_RS12260 WP_010906314.1 2383599..2383883(-) (comGG) [Lactococcus lactis subsp. lactis strain 303]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585