NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	PW220_RS00700	Genome accession	NZ_CP118734
Coordinates	110549..110830 (+)	Length	93 a.a.
NCBI ID	WP_105096850.1	Uniprot ID	-
Organism	Streptococcus iners subsp. hyiners strain 29892
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 105549..115830

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PW220_RS00680 (PW220_00680)	-	107215..107592 (+)	378	WP_172049590.1	DUF1033 family protein	-
PW220_RS00685 (PW220_00685)	-	107613..108563 (-)	951	WP_248049579.1	S66 family peptidase	-
PW220_RS00690 (PW220_00690)	comYA	108648..109607 (+)	960	WP_248055938.1	competence type IV pilus ATPase ComGA	Machinery gene
PW220_RS00695 (PW220_00695)	comYB	109510..110547 (+)	1038	WP_316716460.1	competence type IV pilus assembly protein ComGB	Machinery gene
PW220_RS00700 (PW220_00700)	comYC	110549..110830 (+)	282	WP_105096850.1	competence type IV pilus major pilin ComGC	Machinery gene
PW220_RS00705 (PW220_00705)	comGD	110811..111218 (+)	408	WP_248055939.1	competence type IV pilus minor pilin ComGD	-
PW220_RS00710 (PW220_00710)	comYE	111190..111483 (+)	294	WP_105117571.1	competence type IV pilus minor pilin ComGE	Machinery gene
PW220_RS00715 (PW220_00715)	comGF/cglF	111470..111904 (+)	435	WP_105117572.1	competence type IV pilus minor pilin ComGF	Machinery gene
PW220_RS00720 (PW220_00720)	comGG	111882..112397 (+)	516	WP_248055940.1	competence type IV pilus minor pilin ComGG	-
PW220_RS00725 (PW220_00725)	atlA	112636..114711 (+)	2076	WP_248055941.1	autolysin AtlA	-
PW220_RS00730 (PW220_00730)	-	114965..115768 (+)	804	WP_105117575.1	ABC transporter permease	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10365.36 Da Isoelectric Point: 8.4205

                                >NTDB_id=794666 PW220_RS00700 WP_105096850.1 110549..110830(+) (comYC) [Streptococcus iners subsp. hyiners strain 29892]

MKKLMKLKNKAFTLVEMLVVLLIVSVLLLLFVPNLSKQKEAIKESGGAAVVKVVESQMELYELEHDKEATVADLQAAGYI

TEKQAEEYAKAKK

Nucleotide

Download Length: 282 bp

                                >NTDB_id=794666 PW220_RS00700 WP_105096850.1 110549..110830(+) (comYC) [Streptococcus iners subsp. hyiners strain 29892]

ATGAAAAAATTAATGAAATTGAAAAATAAAGCCTTCACATTGGTGGAAATGTTAGTAGTACTTCTCATTGTTAGTGTGCT

TCTGCTCCTATTTGTGCCTAATTTGAGTAAGCAAAAAGAAGCGATTAAGGAGTCAGGAGGTGCAGCGGTTGTTAAGGTTG

TAGAAAGCCAGATGGAGCTCTATGAATTAGAGCATGATAAGGAAGCAACGGTGGCAGACTTGCAGGCAGCTGGCTACATC

ACTGAAAAACAAGCAGAAGAGTATGCTAAGGCGAAAAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus suis isolate S10	79.57	100	0.796
comGC/cglC	Streptococcus pneumoniae TIGR4	67.391	98.925	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	67.391	98.925	0.667
comGC/cglC	Streptococcus pneumoniae D39	67.391	98.925	0.667
comGC/cglC	Streptococcus pneumoniae R6	67.391	98.925	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	67.391	98.925	0.667
comGC/cglC	Streptococcus mitis SK321	67.391	98.925	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	68.539	95.699	0.656
comYC	Streptococcus mutans UA140	62.5	94.624	0.591
comYC	Streptococcus mutans UA159	62.5	94.624	0.591
comGC	Lactococcus lactis subsp. cremoris KW2	56.818	94.624	0.538
comGC	Staphylococcus aureus N315	49.412	91.398	0.452
comGC	Staphylococcus aureus MW2	49.412	91.398	0.452

Detailed information NTG0794666