Detailed information NTG0789641

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: PUW49_RS01000
• Genome accession: NZ_CP118054
• Coordinates: 187378..187695 (+)
• Length: 105 a.a.
• NCBI ID: WP_003028473.1
• Uniprot ID: A0A0P0N5S2
• Organism: Streptococcus anginosus strain VSI37
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 182378..192695

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW49_RS00970 (PUW49_00970)	-	182503..183033 (+)	531	WP_070241503.1	aromatic acid exporter family protein	-
PUW49_RS00975 (PUW49_00975)	-	183110..183469 (+)	360	WP_003070793.1	MerR family transcriptional regulator	-
PUW49_RS00980 (PUW49_00980)	glnA	183507..184853 (+)	1347	WP_024053132.1	type I glutamate--ammonia ligase	-
PUW49_RS00985 (PUW49_00985)	-	185041..185406 (+)	366	WP_024053131.1	DUF1033 family protein	-
PUW49_RS00990 (PUW49_00990)	comYA	185476..186417 (+)	942	WP_024053130.1	competence type IV pilus ATPase ComGA	Machinery gene
PUW49_RS00995 (PUW49_00995)	comYB	186359..187381 (+)	1023	WP_274994772.1	competence type IV pilus assembly protein ComGB	Machinery gene
PUW49_RS01000 (PUW49_01000)	comYC	187378..187695 (+)	318	WP_003028473.1	competence type IV pilus major pilin ComGC	Machinery gene
PUW49_RS01005 (PUW49_01005)	comYD	187685..188083 (+)	399	WP_022525973.1	competence type IV pilus minor pilin ComGD	Machinery gene
PUW49_RS01010 (PUW49_01010)	comGE/cglE	188055..188348 (+)	294	WP_024053127.1	competence type IV pilus minor pilin ComGE	Machinery gene
PUW49_RS01015 (PUW49_01015)	comGF/cglF	188332..188769 (+)	438	WP_024053126.1	competence type IV pilus minor pilin ComGF	Machinery gene
PUW49_RS01020 (PUW49_01020)	comGG	188750..189076 (+)	327	WP_257360478.1	competence type IV pilus minor pilin ComGG	-
PUW49_RS01025 (PUW49_01025)	comYH	189148..190101 (+)	954	WP_024053125.1	class I SAM-dependent methyltransferase	Machinery gene
PUW49_RS01030 (PUW49_01030)	-	190148..191347 (+)	1200	WP_024053124.1	acetate kinase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11622.72 Da
• Isoelectric Point: 10.1006

>NTDB_id=789641 PUW49_RS01000 WP_003028473.1 187378..187695(+) (comYC) [Streptococcus anginosus strain VSI37]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVNEGT
ITDKQAASYKAYYAKHTKEARSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=789641 PUW49_RS01000 WP_003028473.1 187378..187695(+) (comYC) [Streptococcus anginosus strain VSI37]
ATGAAAAAATTAAAAAGTTTGAAGGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTGCTTCTTATCATCAGTGTTTT
GATGCTCTTATTTGTACCGAATTTGACCAAGCAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAGGCAGAGCTGTTTGAGGTCAATCACACCAATGAAAAAGCGACACTCTCAAAATTAGTCAACGAAGGAACG
ATTACAGACAAGCAGGCAGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCTGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0P0N5S2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	73.333	100	0.733
comYC	Streptococcus mutans UA159	66.667	100	0.667
comYC	Streptococcus mutans UA140	66.667	100	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543