NTDB

Overview

Name	comGF/cglF	Type	Machinery gene
Locus tag	PUW49_RS01015	Genome accession	NZ_CP118054
Coordinates	188332..188769 (+)	Length	145 a.a.
NCBI ID	WP_024053126.1	Uniprot ID	A0A413KLZ8
Organism	Streptococcus anginosus strain VSI37
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 183332..193769

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW49_RS00980 (PUW49_00980)	glnA	183507..184853 (+)	1347	WP_024053132.1	type I glutamate--ammonia ligase	-
PUW49_RS00985 (PUW49_00985)	-	185041..185406 (+)	366	WP_024053131.1	DUF1033 family protein	-
PUW49_RS00990 (PUW49_00990)	comYA	185476..186417 (+)	942	WP_024053130.1	competence type IV pilus ATPase ComGA	Machinery gene
PUW49_RS00995 (PUW49_00995)	comYB	186359..187381 (+)	1023	WP_274994772.1	competence type IV pilus assembly protein ComGB	Machinery gene
PUW49_RS01000 (PUW49_01000)	comYC	187378..187695 (+)	318	WP_003028473.1	competence type IV pilus major pilin ComGC	Machinery gene
PUW49_RS01005 (PUW49_01005)	comYD	187685..188083 (+)	399	WP_022525973.1	competence type IV pilus minor pilin ComGD	Machinery gene
PUW49_RS01010 (PUW49_01010)	comGE/cglE	188055..188348 (+)	294	WP_024053127.1	competence type IV pilus minor pilin ComGE	Machinery gene
PUW49_RS01015 (PUW49_01015)	comGF/cglF	188332..188769 (+)	438	WP_024053126.1	competence type IV pilus minor pilin ComGF	Machinery gene
PUW49_RS01020 (PUW49_01020)	comGG	188750..189076 (+)	327	WP_257360478.1	competence type IV pilus minor pilin ComGG	-
PUW49_RS01025 (PUW49_01025)	comYH	189148..190101 (+)	954	WP_024053125.1	class I SAM-dependent methyltransferase	Machinery gene
PUW49_RS01030 (PUW49_01030)	-	190148..191347 (+)	1200	WP_024053124.1	acetate kinase	-
PUW49_RS01035 (PUW49_01035)	glmS	191742..193556 (+)	1815	WP_024053123.1	glutamine--fructose-6-phosphate transaminase (isomerizing)	-

Sequence

Protein

Download Length: 145 a.a. Molecular weight: 16883.44 Da Isoelectric Point: 10.0408

                                >NTDB_id=789644 PUW49_RS01015 WP_024053126.1 188332..188769(+) (comGF/cglF) [Streptococcus anginosus strain VSI37]

MFKANKVKAFTLLEALIVLFVLSGSVLLFQSMTRLLAFEVQARQHSEQREWLLFADQLEAELARSSFEKVENNRLYMKQD

GRAIAFGKSSGQDFRKTNANGKGYQPMVYDVKKAEISQKNELIYVRLTFRRGLEREFVYRVETES

Nucleotide

Download Length: 438 bp

                                >NTDB_id=789644 PUW49_RS01015 WP_024053126.1 188332..188769(+) (comGF/cglF) [Streptococcus anginosus strain VSI37]

GTGTTCAAGGCAAATAAAGTGAAAGCTTTTACCCTTTTAGAGGCTCTGATTGTCTTATTTGTACTCAGCGGAAGTGTGCT

GCTTTTTCAGTCAATGACGCGTCTTCTGGCTTTTGAAGTTCAAGCCCGGCAACATAGTGAACAACGAGAATGGCTTTTGT

TTGCTGATCAACTAGAAGCAGAGTTGGCTCGTTCTTCATTTGAAAAGGTGGAGAATAATCGTTTATATATGAAACAGGAC

GGCAGGGCAATTGCATTTGGAAAGTCAAGTGGACAGGATTTCAGAAAAACAAATGCGAATGGGAAAGGTTACCAGCCGAT

GGTTTATGATGTAAAAAAAGCAGAAATCTCACAGAAAAATGAGCTGATTTATGTTAGACTGACGTTTAGGCGAGGATTGG

AAAGGGAGTTTGTCTATCGTGTGGAAACAGAAAGTTAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(39-134)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A413KLZ8

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGF/cglF	Streptococcus pneumoniae R6	64.085	97.931	0.628
comGF/cglF	Streptococcus pneumoniae TIGR4	64.085	97.931	0.628
comGF/cglF	Streptococcus pneumoniae Rx1	64.085	97.931	0.628
comGF/cglF	Streptococcus pneumoniae D39	64.085	97.931	0.628
comGF/cglF	Streptococcus mitis NCTC 12261	64.286	96.552	0.621
comGF/cglF	Streptococcus mitis SK321	64.286	96.552	0.621
comYF	Streptococcus mutans UA159	42.963	93.103	0.4
comYF	Streptococcus mutans UA140	42.963	93.103	0.4
comGF	Lactococcus lactis subsp. cremoris KW2	40	93.103	0.372

Detailed information NTG0789644