Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | PO908_RS00750 | Genome accession | NZ_CP117042 |
| Coordinates | 130986..131402 (+) | Length | 138 a.a. |
| NCBI ID | WP_084740667.1 | Uniprot ID | - |
| Organism | Streptococcus anginosus strain CGMH_KH1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 115812..163078 | 130986..131402 | within | 0 |
Gene organization within MGE regions
Location: 115812..163078
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO908_RS00615 (PO908_00615) | - | 115812..116021 (+) | 210 | WP_021001200.1 | heavy-metal-associated domain-containing protein | - |
| PO908_RS00620 (PO908_00620) | - | 116062..116931 (-) | 870 | WP_021001201.1 | RluA family pseudouridine synthase | - |
| PO908_RS00625 (PO908_00625) | pbp2a | 117069..119288 (+) | 2220 | WP_021001202.1 | penicillin-binding protein PBP2A | - |
| PO908_RS00630 (PO908_00630) | rpmG | 119338..119490 (+) | 153 | WP_003027324.1 | 50S ribosomal protein L33 | - |
| PO908_RS00635 (PO908_00635) | secE | 119500..119676 (+) | 177 | WP_003027327.1 | preprotein translocase subunit SecE | - |
| PO908_RS00640 (PO908_00640) | nusG | 119828..120364 (+) | 537 | WP_003027329.1 | transcription termination/antitermination protein NusG | - |
| PO908_RS00645 (PO908_00645) | - | 120659..121726 (-) | 1068 | WP_394467995.1 | site-specific integrase | - |
| PO908_RS00650 (PO908_00650) | - | 121847..122344 (-) | 498 | WP_084740625.1 | hypothetical protein | - |
| PO908_RS00655 (PO908_00655) | - | 122349..122735 (-) | 387 | WP_084740627.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PO908_RS00660 (PO908_00660) | - | 122749..123105 (-) | 357 | WP_084740630.1 | helix-turn-helix domain-containing protein | - |
| PO908_RS00665 (PO908_00665) | - | 123407..123616 (+) | 210 | WP_084740632.1 | helix-turn-helix domain-containing protein | - |
| PO908_RS00670 (PO908_00670) | - | 123626..123790 (+) | 165 | WP_186821899.1 | hypothetical protein | - |
| PO908_RS00675 (PO908_00675) | - | 123785..124570 (-) | 786 | WP_084740635.1 | DUF4393 domain-containing protein | - |
| PO908_RS00680 (PO908_00680) | - | 124622..124789 (+) | 168 | WP_320060451.1 | helix-turn-helix transcriptional regulator | - |
| PO908_RS00685 (PO908_00685) | - | 124924..125121 (+) | 198 | WP_003074857.1 | hypothetical protein | - |
| PO908_RS00690 (PO908_00690) | - | 125130..125492 (+) | 363 | WP_084740641.1 | hypothetical protein | - |
| PO908_RS00695 (PO908_00695) | - | 125514..125798 (+) | 285 | WP_084740643.1 | DNA-binding protein | - |
| PO908_RS00700 (PO908_00700) | - | 125822..126040 (+) | 219 | WP_084740646.1 | hypothetical protein | - |
| PO908_RS00705 (PO908_00705) | - | 126073..126507 (+) | 435 | WP_394467996.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| PO908_RS00710 (PO908_00710) | - | 126504..127886 (+) | 1383 | WP_394467997.1 | PcfJ domain-containing protein | - |
| PO908_RS00715 (PO908_00715) | - | 127899..128789 (+) | 891 | WP_084740649.1 | phage replisome organizer N-terminal domain-containing protein | - |
| PO908_RS00720 (PO908_00720) | - | 128790..129044 (+) | 255 | WP_084740652.1 | hypothetical protein | - |
| PO908_RS00725 (PO908_00725) | - | 129037..129522 (+) | 486 | WP_084740655.1 | MazG-like family protein | - |
| PO908_RS00730 (PO908_00730) | - | 129519..129839 (+) | 321 | WP_261673831.1 | DUF1372 family protein | - |
| PO908_RS00735 (PO908_00735) | - | 129841..130185 (+) | 345 | WP_084740658.1 | DUF3310 domain-containing protein | - |
| PO908_RS00740 (PO908_00740) | - | 130175..130567 (+) | 393 | WP_084740661.1 | hypothetical protein | - |
| PO908_RS00745 (PO908_00745) | - | 130583..130993 (+) | 411 | WP_084740664.1 | YopX family protein | - |
| PO908_RS00750 (PO908_00750) | ssbA | 130986..131402 (+) | 417 | WP_084740667.1 | single-stranded DNA-binding protein | Machinery gene |
| PO908_RS00755 (PO908_00755) | - | 131411..131794 (+) | 384 | WP_084740670.1 | hypothetical protein | - |
| PO908_RS00760 (PO908_00760) | - | 131787..132317 (+) | 531 | WP_084740673.1 | hypothetical protein | - |
| PO908_RS00765 (PO908_00765) | - | 132517..132738 (+) | 222 | WP_084740676.1 | hypothetical protein | - |
| PO908_RS00770 (PO908_00770) | - | 132716..133180 (+) | 465 | WP_084740679.1 | hypothetical protein | - |
| PO908_RS00775 (PO908_00775) | - | 133290..133832 (+) | 543 | WP_084740682.1 | site-specific integrase | - |
| PO908_RS00780 (PO908_00780) | - | 134121..134408 (+) | 288 | WP_394467998.1 | hypothetical protein | - |
| PO908_RS00785 (PO908_00785) | - | 134531..134767 (+) | 237 | WP_261673832.1 | HNH endonuclease | - |
| PO908_RS00790 (PO908_00790) | - | 134855..135340 (+) | 486 | WP_084740690.1 | hypothetical protein | - |
| PO908_RS00795 (PO908_00795) | - | 135333..137045 (+) | 1713 | WP_148131487.1 | terminase TerL endonuclease subunit | - |
| PO908_RS00800 (PO908_00800) | - | 137054..138196 (+) | 1143 | WP_084740693.1 | phage portal protein | - |
| PO908_RS00805 (PO908_00805) | - | 138247..138789 (+) | 543 | WP_084740696.1 | HK97 family phage prohead protease | - |
| PO908_RS00810 (PO908_00810) | - | 138800..140062 (+) | 1263 | WP_084740699.1 | phage major capsid protein | - |
| PO908_RS00815 (PO908_00815) | - | 140086..140421 (+) | 336 | WP_084740700.1 | hypothetical protein | - |
| PO908_RS00820 (PO908_00820) | - | 140418..140723 (+) | 306 | WP_084740701.1 | head-tail adaptor protein | - |
| PO908_RS00825 (PO908_00825) | - | 140723..141070 (+) | 348 | WP_084740703.1 | hypothetical protein | - |
| PO908_RS00830 (PO908_00830) | - | 141057..141401 (+) | 345 | WP_084740706.1 | hypothetical protein | - |
| PO908_RS00835 (PO908_00835) | - | 141416..142093 (+) | 678 | WP_084740709.1 | phage tail protein | - |
| PO908_RS00840 (PO908_00840) | - | 142090..142566 (+) | 477 | WP_084740712.1 | hypothetical protein | - |
| PO908_RS00845 (PO908_00845) | - | 142754..145558 (+) | 2805 | WP_394467999.1 | phage tail tape measure protein | - |
| PO908_RS00850 (PO908_00850) | - | 145555..146277 (+) | 723 | WP_084740718.1 | phage tail protein | - |
| PO908_RS00855 | - | 146278..150114 (+) | 3837 | WP_394468000.1 | phage tail spike protein | - |
| PO908_RS00860 (PO908_00860) | - | 150127..150354 (+) | 228 | WP_394468001.1 | hypothetical protein | - |
| PO908_RS00865 (PO908_00865) | - | 150357..150608 (+) | 252 | WP_204972203.1 | hypothetical protein | - |
| PO908_RS00870 (PO908_00870) | - | 150669..151037 (+) | 369 | WP_394468002.1 | hypothetical protein | - |
| PO908_RS00875 (PO908_00875) | - | 151048..151332 (+) | 285 | WP_084740732.1 | phage holin | - |
| PO908_RS00880 (PO908_00880) | - | 151335..152141 (+) | 807 | WP_186821897.1 | lytic exoenzyme target recognition domain-containing protein | - |
| PO908_RS00885 (PO908_00885) | - | 152269..152400 (+) | 132 | WP_255777072.1 | hypothetical protein | - |
| PO908_RS00890 (PO908_00890) | - | 152556..152735 (+) | 180 | WP_039677487.1 | hypothetical protein | - |
| PO908_RS00900 (PO908_00900) | - | 153054..153293 (-) | 240 | WP_022526394.1 | hypothetical protein | - |
| PO908_RS00905 (PO908_00905) | - | 153459..154411 (-) | 953 | Protein_157 | IS30 family transposase | - |
| PO908_RS00990 (PO908_00990) | - | 161109..161228 (-) | 120 | Protein_158 | site-specific integrase | - |
| PO908_RS00995 (PO908_00995) | - | 161384..161538 (-) | 155 | Protein_159 | GTP pyrophosphokinase | - |
| PO908_RS01000 (PO908_01000) | - | 161716..161973 (+) | 258 | WP_003027150.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PO908_RS01005 (PO908_01005) | - | 161970..162326 (+) | 357 | Protein_161 | type II toxin-antitoxin system death-on-curing family toxin | - |
| PO908_RS01010 (PO908_01010) | - | 162436..162711 (-) | 276 | Protein_162 | multiprotein-bridging factor 1 family protein | - |
| PO908_RS01015 (PO908_01015) | - | 162698..163078 (-) | 381 | WP_003027145.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15708.56 Da Isoelectric Point: 4.8837
>NTDB_id=782213 PO908_RS00750 WP_084740667.1 130986..131402(+) (ssbA) [Streptococcus anginosus strain CGMH_KH1]
MINNVVLIGRLTRDPELRYTPSNIAVATFNLAVNRNFKNQDGEREADFINCVMWQKSAENLANWTRKGMLIGVTGRIQTR
SYENQQGQRVHVTEIVAETFQVLEKRDNSANQSSMDSQMPPNFGNSQPMDISDDDLPF
MINNVVLIGRLTRDPELRYTPSNIAVATFNLAVNRNFKNQDGEREADFINCVMWQKSAENLANWTRKGMLIGVTGRIQTR
SYENQQGQRVHVTEIVAETFQVLEKRDNSANQSSMDSQMPPNFGNSQPMDISDDDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=782213 PO908_RS00750 WP_084740667.1 130986..131402(+) (ssbA) [Streptococcus anginosus strain CGMH_KH1]
ATGATTAACAATGTTGTTTTAATTGGTCGTTTAACTCGTGATCCCGAGCTACGCTACACACCATCCAATATAGCTGTTGC
GACTTTCAACTTGGCCGTAAATCGTAATTTTAAAAATCAAGATGGCGAGCGAGAAGCTGATTTTATCAACTGTGTTATGT
GGCAGAAATCGGCTGAGAATCTAGCAAATTGGACACGAAAAGGTATGTTGATTGGGGTTACAGGTCGCATTCAGACACGT
AGTTATGAAAATCAACAGGGTCAACGTGTCCATGTGACGGAGATTGTCGCAGAGACTTTCCAAGTTTTGGAAAAGCGGGA
TAACTCTGCTAATCAGTCAAGCATGGATAGTCAGATGCCACCAAATTTTGGGAATAGCCAGCCGATGGATATCTCAGATG
ATGATTTGCCGTTTTAG
ATGATTAACAATGTTGTTTTAATTGGTCGTTTAACTCGTGATCCCGAGCTACGCTACACACCATCCAATATAGCTGTTGC
GACTTTCAACTTGGCCGTAAATCGTAATTTTAAAAATCAAGATGGCGAGCGAGAAGCTGATTTTATCAACTGTGTTATGT
GGCAGAAATCGGCTGAGAATCTAGCAAATTGGACACGAAAAGGTATGTTGATTGGGGTTACAGGTCGCATTCAGACACGT
AGTTATGAAAATCAACAGGGTCAACGTGTCCATGTGACGGAGATTGTCGCAGAGACTTTCCAAGTTTTGGAAAAGCGGGA
TAACTCTGCTAATCAGTCAAGCATGGATAGTCAGATGCCACCAAATTTTGGGAATAGCCAGCCGATGGATATCTCAGATG
ATGATTTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.326 |
100 |
0.652 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.652 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
47.857 |
100 |
0.486 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
76.812 |
0.435 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.029 |
100 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.029 |
100 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.029 |
100 |
0.42 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.029 |
100 |
0.42 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.377 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
46.018 |
81.884 |
0.377 |
| ssbA | Streptococcus mutans UA159 |
47.273 |
79.71 |
0.377 |
| ssb | Vibrio cholerae strain A1552 |
28.902 |
100 |
0.362 |