Detailed information NTG0776537

Bioinformatically predicted

Overview

• Name: pilA/pilAI
• Type: Machinery gene
• Locus tag: PJW04_RS16420
• Genome accession: NZ_CP116305
• Coordinates: 3747125..3747517 (-)
• Length: 130 a.a.
• NCBI ID: WP_008576871.1
• Uniprot ID: A0A6P0G6X8
• Organism: Xanthomonas perforans strain GEV872
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3737800..3746568	3747125..3747517	flank	557

Gene organization within MGE regions

Location: 3737800..3747517

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PJW04_RS16375 (PJW04_16375)	-	3737800..3738072 (-)	273	Protein_3202	type IV-A pilus assembly ATPase PilB	-
PJW04_RS16385 (PJW04_16385)	pilB	3739274..3740740 (-)	1467	Protein_3204	type IV-A pilus assembly ATPase PilB	-
PJW04_RS16390 (PJW04_16390)	-	3740997..3741854 (+)	858	WP_074053368.1	glycosyltransferase family 2 protein	-
PJW04_RS16395 (PJW04_16395)	-	3741847..3743013 (+)	1167	WP_077708931.1	glycosyltransferase	-
PJW04_RS16400 (PJW04_16400)	-	3743005..3743877 (-)	873	WP_008577868.1	lysylphosphatidylglycerol synthase domain-containing protein	-
PJW04_RS16405 (PJW04_16405)	-	3743916..3744752 (-)	837	WP_074053365.1	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	-
PJW04_RS16410 (PJW04_16410)	-	3744736..3746568 (-)	1833	WP_008576878.1	hypothetical protein	-
PJW04_RS16415 (PJW04_16415)	-	3746613..3747032 (-)	420	WP_033479197.1	pilin	-
PJW04_RS16420 (PJW04_16420)	pilA/pilAI	3747125..3747517 (-)	393	WP_008576871.1	pilin	Machinery gene

Sequence

Protein

• Length: 130 a.a.
• Molecular weight: 13565.77 Da
• Isoelectric Point: 9.5775

>NTDB_id=776537 PJW04_RS16420 WP_008576871.1 3747125..3747517(-) (pilA/pilAI) [Xanthomonas perforans strain GEV872]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQVTAGLAEITPGKTQFEVKTNEGSTMSTPAQIGLSSSTTRCGI
TVSATTIVCNLKGNAAKVKDKNVTLTRTASTGTWACSSSVDAKYKPAGCS

Nucleotide

• Length: 393 bp

>NTDB_id=776537 PJW04_RS16420 WP_008576871.1 3747125..3747517(-) (pilA/pilAI) [Xanthomonas perforans strain GEV872]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTGGTCGCGATCATTGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTCGCCAAGTCGCAGGTGACTGCTGGTCTGGCCGAAATCACCCCGGGCAAGACTCAGTTCG
AAGTTAAGACCAACGAAGGCAGCACGATGAGCACCCCCGCGCAGATTGGTCTAAGCTCGTCCACCACGCGTTGTGGCATC
ACGGTTTCCGCTACTACCATTGTTTGCAACCTTAAAGGAAACGCGGCAAAGGTCAAGGATAAGAACGTGACACTGACGCG
TACCGCTAGCACGGGAACTTGGGCTTGCAGCAGCAGTGTTGACGCGAAGTACAAGCCGGCTGGCTGCAGCTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

• Pilin (bacterial filament) (Pilin) (35-129)

3D structure

• AlphaFold DB: A0A6P0G6X8

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA/pilAI	Pseudomonas stutzeri DSM 10701	55.556	100	0.577
pilA	Acinetobacter baumannii strain A118	46.763	100	0.5
pilA/pilAII	Pseudomonas stutzeri DSM 10701	47.368	100	0.485
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	43.056	100	0.477
pilA	Vibrio cholerae strain A1552	43.056	100	0.477
pilA	Vibrio cholerae C6706	43.056	100	0.477
pilA	Pseudomonas aeruginosa PAK	41.611	100	0.477
comP	Acinetobacter baylyi ADP1	40.541	100	0.462
pilA2	Legionella pneumophila str. Paris	37.931	100	0.423
pilA2	Legionella pneumophila strain ERS1305867	37.931	100	0.423
pilA/pilA1	Eikenella corrodens VA1	36.242	100	0.415
pilA	Vibrio parahaemolyticus RIMD 2210633	42.742	95.385	0.408
pilE	Neisseria gonorrhoeae strain FA1090	30.719	100	0.362