NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	OIY87_RS00715	Genome accession	NZ_CP113954
Coordinates	108846..109139 (+)	Length	97 a.a.
NCBI ID	WP_009853231.1	Uniprot ID	-
Organism	Streptococcus gallolyticus strain XH2168
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 103846..114139

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OIY87_RS00700 (OIY87_01995)	-	106498..106866 (+)	369	WP_269725070.1	DUF1033 family protein	-
OIY87_RS00705 (OIY87_02000)	comYA	106938..107879 (+)	942	WP_257073582.1	competence type IV pilus ATPase ComGA	Machinery gene
OIY87_RS00710 (OIY87_02005)	comYB	107761..108846 (+)	1086	WP_012961328.1	competence type IV pilus assembly protein ComGB	Machinery gene
OIY87_RS00715 (OIY87_02010)	comYC	108846..109139 (+)	294	WP_009853231.1	competence type IV pilus major pilin ComGC	Machinery gene
OIY87_RS00720 (OIY87_02015)	comYD	109123..109554 (+)	432	WP_009853232.1	competence type IV pilus minor pilin ComGD	Machinery gene
OIY87_RS00725 (OIY87_02020)	comGE	109508..109801 (+)	294	WP_012961329.1	competence type IV pilus minor pilin ComGE	-
OIY87_RS00730 (OIY87_02025)	comYF	109755..110222 (+)	468	WP_012961330.1	competence type IV pilus minor pilin ComGF	Machinery gene
OIY87_RS00735 (OIY87_02030)	comYG	110194..110526 (+)	333	WP_420067733.1	competence type IV pilus minor pilin ComGG	Machinery gene
OIY87_RS00740 (OIY87_02035)	comYH	110581..111537 (+)	957	WP_009853236.1	class I SAM-dependent methyltransferase	Machinery gene
OIY87_RS00745 (OIY87_02040)	-	111590..112789 (+)	1200	WP_061458770.1	acetate kinase	-
OIY87_RS00750 (OIY87_02045)	-	112951..113151 (+)	201	WP_269725072.1	helix-turn-helix transcriptional regulator	-
OIY87_RS00755 (OIY87_02050)	-	113161..113391 (+)	231	WP_269725073.1	chaperone CbpA	-
OIY87_RS00760 (OIY87_02055)	-	113382..113834 (+)	453	WP_061458772.1	hypothetical protein	-

Sequence

Protein

Download Length: 97 a.a. Molecular weight: 11042.18 Da Isoelectric Point: 9.9310

                                >NTDB_id=763797 OIY87_RS00715 WP_009853231.1 108846..109139(+) (comYC) [Streptococcus gallolyticus strain XH2168]

MKKIWKKLRQKTVKGFTLVEMLIVLLIISVLMLLFVPNLSKQKDVVREKGDAAVVKVVESQMDLYEVKTGDKPTVDDLVE

VGYITSEQAKTYNEAKK

Nucleotide

Download Length: 294 bp

                                >NTDB_id=763797 OIY87_RS00715 WP_009853231.1 108846..109139(+) (comYC) [Streptococcus gallolyticus strain XH2168]

ATGAAAAAGATTTGGAAAAAATTACGTCAGAAAACGGTAAAAGGGTTCACACTTGTGGAGATGTTGATTGTGCTTCTTAT

TATCAGTGTTTTAATGTTGCTTTTTGTACCGAATTTGAGTAAGCAAAAGGACGTTGTTCGTGAAAAAGGCGATGCTGCTG

TTGTGAAAGTGGTAGAGAGCCAAATGGATTTGTACGAAGTGAAAACGGGAGATAAACCGACTGTTGATGATTTAGTTGAA

GTTGGCTACATCACTTCTGAACAAGCAAAAACTTACAATGAAGCTAAAAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(13-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus suis isolate S10	67.391	94.845	0.639
comYC	Streptococcus gordonii str. Challis substr. CH1	64.773	90.722	0.588
comGC/cglC	Streptococcus mitis SK321	60.638	96.907	0.588
comGC/cglC	Streptococcus pneumoniae R6	59.574	96.907	0.577
comGC/cglC	Streptococcus mitis NCTC 12261	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae TIGR4	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae Rx1	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae D39	59.574	96.907	0.577
comYC	Streptococcus mutans UA140	58.427	91.753	0.536
comYC	Streptococcus mutans UA159	58.427	91.753	0.536
comGC	Lactococcus lactis subsp. cremoris KW2	56.667	92.784	0.526

Detailed information NTG0763797