NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	N2A96_RS00860	Genome accession	NZ_CP104047
Coordinates	139666..139992 (+)	Length	108 a.a.
NCBI ID	WP_004347181.1	Uniprot ID	A0A0E2UAV4
Organism	Streptococcus parauberis strain KSP10
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 134666..144992

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
N2A96_RS00845 (N2A96_00845)	-	137333..137707 (+)	375	WP_003103833.1	DUF1033 family protein	-
N2A96_RS00850 (N2A96_00850)	comYA	137761..138702 (+)	942	WP_004347183.1	competence type IV pilus ATPase ComGA	Machinery gene
N2A96_RS00855 (N2A96_00855)	comYB	138614..139669 (+)	1056	WP_142379024.1	competence type IV pilus assembly protein ComGB	Machinery gene
N2A96_RS00860 (N2A96_00860)	comYC	139666..139992 (+)	327	WP_004347181.1	competence type IV pilus major pilin ComGC	Machinery gene
N2A96_RS00865 (N2A96_00865)	comGD	139982..140389 (+)	408	WP_239639209.1	competence type IV pilus minor pilin ComGD	-
N2A96_RS00870 (N2A96_00870)	comGE	140361..140660 (+)	300	WP_003104125.1	competence type IV pilus minor pilin ComGE	-
N2A96_RS00875 (N2A96_00875)	comGF	140638..141075 (+)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	-
N2A96_RS00880 (N2A96_00880)	comGG	141053..141550 (+)	498	WP_004347175.1	competence type IV pilus minor pilin ComGG	-
N2A96_RS00885 (N2A96_00885)	comYH	141657..142613 (+)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
N2A96_RS00890 (N2A96_00890)	-	142669..143862 (+)	1194	WP_004347172.1	acetate kinase	-
N2A96_RS00895 (N2A96_00895)	-	143973..144185 (+)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
N2A96_RS00900 (N2A96_00900)	-	144178..144630 (+)	453	WP_003108634.1	hypothetical protein	-

Sequence

Protein

Download Length: 108 a.a. Molecular weight: 12269.52 Da Isoelectric Point: 10.0279

                                >NTDB_id=727280 N2A96_RS00860 WP_004347181.1 139666..139992(+) (comYC) [Streptococcus parauberis strain KSP10]

MKKFIINFKNKSVQAFTLLEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLK

SNGNLTEKQITAYNDYYKKHSDKIPNVK

Nucleotide

Download Length: 327 bp

                                >NTDB_id=727280 N2A96_RS00860 WP_004347181.1 139666..139992(+) (comYC) [Streptococcus parauberis strain KSP10]

ATGAAAAAATTTATTATTAATTTTAAAAACAAATCAGTACAAGCATTCACTCTTTTAGAGATGCTAATGGTTATTCTTAT

TATTTCTATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTC

TAGTTAAAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAG

AGCAATGGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGT

TAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0E2UAV4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus mutans UA140	57	92.593	0.528
comYC	Streptococcus mutans UA159	57	92.593	0.528
comGC/cglC	Streptococcus mitis SK321	54.455	93.519	0.509
comGC/cglC	Streptococcus mitis NCTC 12261	53	92.593	0.491
comGC/cglC	Streptococcus pneumoniae TIGR4	52.475	93.519	0.491
comGC/cglC	Streptococcus pneumoniae R6	52.475	93.519	0.491
comGC/cglC	Streptococcus pneumoniae D39	52.475	93.519	0.491
comGC/cglC	Streptococcus pneumoniae Rx1	52.475	93.519	0.491
comYC	Streptococcus gordonii str. Challis substr. CH1	55.789	87.963	0.491
comGC	Lactococcus lactis subsp. cremoris KW2	52.083	88.889	0.463
comGC	Staphylococcus aureus MW2	47.561	75.926	0.361
comGC	Staphylococcus aureus N315	47.561	75.926	0.361
comYC	Streptococcus suis isolate S10	48.148	75	0.361

Detailed information NTG0727280