Detailed information NTG0720625

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: NW971_RS08115
• Genome accession: NZ_CP102962
• Coordinates: 1652111..1652422 (-)
• Length: 103 a.a.
• NCBI ID: WP_111762334.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 16CS0212
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1647111..1657422

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NW971_RS08080 (NW971_08080)	gcvPA	1647613..1648959 (-)	1347	WP_210602827.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
NW971_RS08085 (NW971_08085)	gcvT	1648979..1650070 (-)	1092	WP_258464271.1	glycine cleavage system aminomethyltransferase GcvT	-
NW971_RS08090 (NW971_08090)	-	1650229..1650753 (-)	525	WP_258464272.1	shikimate kinase	-
NW971_RS08095 (NW971_08095)	-	1650743..1650889 (-)	147	WP_001789879.1	hypothetical protein	-
NW971_RS08100 (NW971_08100)	comGF	1650986..1651483 (-)	498	WP_029693246.1	competence type IV pilus minor pilin ComGF	Machinery gene
NW971_RS08105 (NW971_08105)	comGE	1651401..1651700 (-)	300	WP_258464273.1	competence protein ComGE	Machinery gene
NW971_RS08110 (NW971_08110)	comGD	1651687..1652133 (-)	447	WP_258464274.1	competence type IV pilus minor pilin ComGD	Machinery gene
NW971_RS08115 (NW971_08115)	comGC	1652111..1652422 (-)	312	WP_111762334.1	competence type IV pilus major pilin ComGC	Machinery gene
NW971_RS08120 (NW971_08120)	comGB	1652436..1653506 (-)	1071	WP_000776405.1	competence type IV pilus assembly protein ComGB	Machinery gene
NW971_RS08125 (NW971_08125)	comGA	1653478..1654452 (-)	975	WP_258464275.1	competence type IV pilus ATPase ComGA	Machinery gene
NW971_RS08130 (NW971_08130)	-	1654504..1655127 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
NW971_RS08135 (NW971_08135)	-	1655124..1655453 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
NW971_RS08140 (NW971_08140)	-	1655453..1656439 (-)	987	WP_000161315.1	ROK family glucokinase	-
NW971_RS08145 (NW971_08145)	-	1656436..1656639 (-)	204	WP_258464276.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11281.34 Da
• Isoelectric Point: 8.5268

>NTDB_id=720625 NW971_RS08115 WP_111762334.1 1652111..1652422(-) (comGC) [Staphylococcus aureus strain 16CS0212]
MFKLLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=720625 NW971_RS08115 WP_111762334.1 1652111..1652422(-) (comGC) [Staphylococcus aureus strain 16CS0212]
ATGTTTAAATTACTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTGAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comYC	Streptococcus gordonii str. Challis substr. CH1	43.81	100	0.447
comGC/cglC	Streptococcus mitis SK321	46.809	91.262	0.427
comGC/cglC	Streptococcus pneumoniae R6	45.745	91.262	0.417
comGC/cglC	Streptococcus pneumoniae TIGR4	45.745	91.262	0.417
comGC/cglC	Streptococcus pneumoniae Rx1	45.745	91.262	0.417
comGC/cglC	Streptococcus pneumoniae D39	45.745	91.262	0.417
comGC/cglC	Streptococcus mitis NCTC 12261	50	83.495	0.417
comYC	Streptococcus suis isolate S10	49.412	82.524	0.408
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369