Detailed information NTG0717892

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: MOP79_RS09205
• Genome accession: NZ_CP102583
• Coordinates: 1813001..1813327 (+)
• Length: 108 a.a.
• NCBI ID: WP_000738626.1
• Uniprot ID: Q8DN88
• Organism: Streptococcus pneumoniae strain D39Mega17545
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1808001..1818327

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MOP79_RS09180	nagA	1808130..1809281 (+)	1152	WP_001134457.1	N-acetylglucosamine-6-phosphate deacetylase	-
MOP79_RS09185	-	1809444..1810502 (+)	1059	WP_000649468.1	zinc-dependent alcohol dehydrogenase family protein	-
MOP79_RS09190	-	1810653..1811018 (+)	366	WP_000286412.1	DUF1033 family protein	-
MOP79_RS09195	comGA/cglA/cilD	1811094..1812035 (+)	942	WP_000249564.1	competence type IV pilus ATPase ComGA	Machinery gene
MOP79_RS09200	comGB/cglB	1811983..1812999 (+)	1017	WP_074196785.1	competence type IV pilus assembly protein ComGB	Machinery gene
MOP79_RS09205	comGC/cglC	1813001..1813327 (+)	327	WP_000738626.1	comG operon protein ComGC	Machinery gene
MOP79_RS09210	comGD/cglD	1813320..1813724 (+)	405	WP_000588026.1	competence type IV pilus minor pilin ComGD	Machinery gene
MOP79_RS09215	comGE/cglE	1813687..1813989 (+)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
MOP79_RS09220	comGF/cglF	1813952..1814413 (+)	462	WP_000250534.1	competence type IV pilus minor pilin ComGF	Machinery gene
MOP79_RS09225	comGG/cglG	1814391..1814804 (+)	414	WP_000265622.1	competence type IV pilus minor pilin ComGG	Machinery gene
MOP79_RS09230	-	1814941..1815535 (+)	595	Protein_1830	class I SAM-dependent methyltransferase	-
MOP79_RS09235	comYH	1815596..1816549 (+)	954	WP_000345135.1	class I SAM-dependent methyltransferase	Machinery gene
MOP79_RS09240	-	1816600..1817790 (+)	1191	WP_000167757.1	acetate kinase	-
MOP79_RS09245	-	1817791..1817922 (+)	132	WP_000768904.1	hypothetical protein	-
MOP79_RS09250	rnpA	1817939..1818310 (+)	372	WP_000739246.1	ribonuclease P protein component	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12200.38 Da
• Isoelectric Point: 10.1877

>NTDB_id=717892 MOP79_RS09205 WP_000738626.1 1813001..1813327(+) (comGC/cglC) [Streptococcus pneumoniae strain D39Mega17545]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQA
DGRITEEQAKAYKEYHDKNGGANRKVND

Nucleotide

• Length: 327 bp

>NTDB_id=717892 MOP79_RS09205 WP_000738626.1 1813001..1813327(+) (comGC/cglC) [Streptococcus pneumoniae strain D39Mega17545]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTAGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGCA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGAGGAGCAAATCGTAAAGTCAA
TGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

3D structure

• PDB: 6Y1H

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	100	100	1
comGC/cglC	Streptococcus pneumoniae D39	100	100	1
comGC/cglC	Streptococcus pneumoniae R6	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	99.074	100	0.991
comGC/cglC	Streptococcus mitis SK321	94.444	100	0.944
comGC/cglC	Streptococcus mitis NCTC 12261	92.157	94.444	0.87
comYC	Streptococcus gordonii str. Challis substr. CH1	67.961	95.37	0.648
comYC	Streptococcus mutans UA140	62.745	94.444	0.593
comYC	Streptococcus mutans UA159	62.745	94.444	0.593
comYC	Streptococcus suis isolate S10	70.37	75	0.528
comGC	Lactococcus lactis subsp. cremoris KW2	53.922	94.444	0.509
comGC	Staphylococcus aureus MW2	50	79.63	0.398
comGC	Staphylococcus aureus N315	50	79.63	0.398
comGC	Latilactobacillus sakei subsp. sakei 23K	45.349	79.63	0.361