NTDB

Overview

Name	comGG/cglG	Type	Machinery gene
Locus tag	MOP79_RS09225	Genome accession	NZ_CP102583
Coordinates	1814391..1814804 (+)	Length	137 a.a.
NCBI ID	WP_000265622.1	Uniprot ID	Q8CY84
Organism	Streptococcus pneumoniae strain D39Mega17545
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1809391..1819804

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MOP79_RS09185	-	1809444..1810502 (+)	1059	WP_000649468.1	zinc-dependent alcohol dehydrogenase family protein	-
MOP79_RS09190	-	1810653..1811018 (+)	366	WP_000286412.1	DUF1033 family protein	-
MOP79_RS09195	comGA/cglA/cilD	1811094..1812035 (+)	942	WP_000249564.1	competence type IV pilus ATPase ComGA	Machinery gene
MOP79_RS09200	comGB/cglB	1811983..1812999 (+)	1017	WP_074196785.1	competence type IV pilus assembly protein ComGB	Machinery gene
MOP79_RS09205	comGC/cglC	1813001..1813327 (+)	327	WP_000738626.1	comG operon protein ComGC	Machinery gene
MOP79_RS09210	comGD/cglD	1813320..1813724 (+)	405	WP_000588026.1	competence type IV pilus minor pilin ComGD	Machinery gene
MOP79_RS09215	comGE/cglE	1813687..1813989 (+)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
MOP79_RS09220	comGF/cglF	1813952..1814413 (+)	462	WP_000250534.1	competence type IV pilus minor pilin ComGF	Machinery gene
MOP79_RS09225	comGG/cglG	1814391..1814804 (+)	414	WP_000265622.1	competence type IV pilus minor pilin ComGG	Machinery gene
MOP79_RS09230	-	1814941..1815535 (+)	595	Protein_1830	class I SAM-dependent methyltransferase	-
MOP79_RS09235	comYH	1815596..1816549 (+)	954	WP_000345135.1	class I SAM-dependent methyltransferase	Machinery gene
MOP79_RS09240	-	1816600..1817790 (+)	1191	WP_000167757.1	acetate kinase	-
MOP79_RS09245	-	1817791..1817922 (+)	132	WP_000768904.1	hypothetical protein	-
MOP79_RS09250	rnpA	1817939..1818310 (+)	372	WP_000739246.1	ribonuclease P protein component	-
MOP79_RS09255	-	1818285..1819109 (+)	825	WP_000727904.1	membrane protein insertase YidC	-

Sequence

Protein

Download Length: 137 a.a. Molecular weight: 16003.46 Da Isoelectric Point: 10.2472

                                >NTDB_id=717896 MOP79_RS09225 WP_000265622.1 1814391..1814804(+) (comGG/cglG) [Streptococcus pneumoniae strain D39Mega17545]

MWKKKKVKAGVLLYAVTIAAIFSLLLQFYLNRQVAHYQDYALNKEKLVAFAMAKRTKDKVEQESGEQFFNLGQVSYQNKK

TGLVTRVRTDKSQYEFLFPSVKIKEEKRDKKEEVATDSSEKVEKKKSEEKPEKKENS

Nucleotide

Download Length: 414 bp

                                >NTDB_id=717896 MOP79_RS09225 WP_000265622.1 1814391..1814804(+) (comGG/cglG) [Streptococcus pneumoniae strain D39Mega17545]

GTGTGGAAAAAGAAAAAAGTTAAGGCAGGTGTTCTCCTCTACGCAGTCACCATAGCAGCCATCTTTAGTCTTTTGTTGCA

ATTTTATTTGAACCGACAAGTCGCCCACTATCAAGACTATGCTTTGAATAAAGAAAAATTGGTTGCTTTTGCTATGGCTA

AACGAACCAAAGATAAGGTTGAGCAAGAAAGTGGGGAACAGTTTTTTAATCTAGGTCAGGTAAGCTATCAAAACAAGAAA

ACTGGCTTAGTGACGAGGGTTCGTACGGATAAGAGCCAATATGAGTTTCTGTTTCCTTCAGTCAAAATCAAAGAAGAGAA

AAGAGATAAAAAGGAAGAGGTAGCGACCGATTCAAGCGAAAAAGTGGAGAAGAAAAAATCAGAAGAGAAGCCTGAAAAGA

AAGAGAATTCATAG

Domains

No domain identified.

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q8CY84

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGG/cglG	Streptococcus pneumoniae Rx1	100	100	1
comGG/cglG	Streptococcus pneumoniae D39	100	100	1
comGG/cglG	Streptococcus pneumoniae R6	100	100	1
comGG/cglG	Streptococcus pneumoniae TIGR4	100	100	1
comGG/cglG	Streptococcus mitis SK321	87.591	100	0.876
comGG/cglG	Streptococcus mitis NCTC 12261	89.256	88.321	0.788
comYG	Streptococcus mutans UA140	38.806	97.81	0.38
comYG	Streptococcus mutans UA159	38.806	97.81	0.38

Detailed information NTG0717896