Detailed information
Overview
| Name | pilE | Type | Machinery gene |
| Locus tag | MIH19_RS04945 | Genome accession | NZ_CP092289 |
| Coordinates | 1039286..1039720 (-) | Length | 144 a.a. |
| NCBI ID | WP_283164098.1 | Uniprot ID | - |
| Organism | Marinobacter sp. M1C | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1030151..1052171 | 1039286..1039720 | within | 0 |
Gene organization within MGE regions
Location: 1030151..1052171
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MIH19_RS04905 (MIH19_04905) | - | 1030151..1030585 (-) | 435 | WP_249007810.1 | adenylyltransferase/cytidyltransferase family protein | - |
| MIH19_RS04910 (MIH19_04910) | - | 1030578..1032923 (-) | 2346 | WP_249007811.1 | glycosyltransferase | - |
| MIH19_RS04915 (MIH19_04915) | - | 1033128..1033940 (-) | 813 | WP_249007812.1 | methionine biosynthesis protein MetW | - |
| MIH19_RS04920 (MIH19_04920) | - | 1033937..1035664 (-) | 1728 | WP_249007813.1 | ABC transporter ATP-binding protein | - |
| MIH19_RS04925 (MIH19_04925) | - | 1035734..1036582 (-) | 849 | WP_249007814.1 | glycosyltransferase family 2 protein | - |
| MIH19_RS04930 (MIH19_04930) | - | 1036603..1038573 (-) | 1971 | WP_249007815.1 | hypothetical protein | - |
| MIH19_RS04935 (MIH19_04935) | - | 1038623..1039051 (-) | 429 | WP_283164097.1 | pilin | - |
| MIH19_RS04945 (MIH19_04945) | pilE | 1039286..1039720 (-) | 435 | WP_283164098.1 | pilin | Machinery gene |
| MIH19_RS04955 (MIH19_04955) | - | 1040088..1040324 (-) | 237 | WP_249007816.1 | hypothetical protein | - |
| MIH19_RS04960 (MIH19_04960) | - | 1040577..1041008 (-) | 432 | WP_249007817.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| MIH19_RS04965 (MIH19_04965) | - | 1041049..1041231 (-) | 183 | WP_249007818.1 | type II toxin-antitoxin system HicA family toxin | - |
| MIH19_RS04970 (MIH19_04970) | - | 1041336..1041878 (-) | 543 | WP_249007819.1 | hypothetical protein | - |
| MIH19_RS04975 (MIH19_04975) | - | 1042013..1042279 (+) | 267 | WP_249007820.1 | YlcI/YnfO family protein | - |
| MIH19_RS04980 (MIH19_04980) | - | 1042276..1042575 (+) | 300 | WP_249007821.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MIH19_RS22515 | - | 1042812..1042928 (+) | 117 | WP_349292920.1 | hypothetical protein | - |
| MIH19_RS04990 (MIH19_04990) | - | 1042930..1043232 (+) | 303 | WP_249007822.1 | helix-turn-helix domain-containing protein | - |
| MIH19_RS04995 (MIH19_04995) | - | 1043350..1043730 (+) | 381 | WP_249007823.1 | helix-turn-helix transcriptional regulator | - |
| MIH19_RS05000 (MIH19_05000) | - | 1043762..1043881 (-) | 120 | Protein_974 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MIH19_RS05005 (MIH19_05005) | - | 1044024..1044212 (+) | 189 | Protein_975 | ATP-binding protein | - |
| MIH19_RS05010 (MIH19_05010) | bamE | 1044322..1044795 (-) | 474 | WP_249007824.1 | outer membrane protein assembly factor BamE | - |
| MIH19_RS05015 (MIH19_05015) | - | 1045059..1045331 (-) | 273 | WP_249007825.1 | type II toxin-antitoxin system YafQ family toxin | - |
| MIH19_RS05020 (MIH19_05020) | - | 1045331..1045588 (-) | 258 | WP_249007826.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| MIH19_RS05025 (MIH19_05025) | - | 1045940..1046434 (-) | 495 | WP_249007827.1 | MgtC/SapB family protein | - |
| MIH19_RS22405 | - | 1046494..1046616 (+) | 123 | WP_283164099.1 | hypothetical protein | - |
| MIH19_RS05030 (MIH19_05030) | - | 1046785..1047300 (+) | 516 | WP_249007828.1 | sn-glycerol-3-phosphate transporter | - |
| MIH19_RS05035 (MIH19_05035) | - | 1047610..1047696 (-) | 87 | WP_249008946.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| MIH19_RS05040 (MIH19_05040) | - | 1047798..1047929 (-) | 132 | WP_249007829.1 | type II toxin-antitoxin system HicA family toxin | - |
| MIH19_RS05045 (MIH19_05045) | - | 1048209..1048559 (+) | 351 | WP_249007830.1 | DUF2784 domain-containing protein | - |
| MIH19_RS05050 (MIH19_05050) | - | 1048746..1049003 (+) | 258 | WP_249007831.1 | helix-turn-helix transcriptional regulator | - |
| MIH19_RS05055 (MIH19_05055) | - | 1049035..1049325 (-) | 291 | WP_249007832.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MIH19_RS05060 (MIH19_05060) | - | 1049315..1049563 (-) | 249 | WP_249007833.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| MIH19_RS05065 (MIH19_05065) | - | 1049742..1049996 (-) | 255 | WP_249008947.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MIH19_RS05070 (MIH19_05070) | - | 1050023..1050295 (-) | 273 | WP_249007834.1 | CopG family ribbon-helix-helix protein | - |
| MIH19_RS05075 (MIH19_05075) | - | 1050456..1051040 (-) | 585 | WP_249007835.1 | histidine phosphatase family protein | - |
| MIH19_RS05080 (MIH19_05080) | - | 1051073..1051279 (-) | 207 | WP_249007836.1 | hypothetical protein | - |
| MIH19_RS05085 (MIH19_05085) | - | 1051428..1052171 (-) | 744 | WP_249007837.1 | ParA family protein | - |
Sequence
Protein
Download Length: 144 a.a. Molecular weight: 15031.03 Da Isoelectric Point: 4.1546
>NTDB_id=656566 MIH19_RS04945 WP_283164098.1 1039286..1039720(-) (pilE) [Marinobacter sp. M1C]
MNKIQQGFTLIELMIVVAIIGILAAIAIPAYQDYTIRAQVSEGLVLASGAKTALAEFYNSTGRFPGDNDSLGLQAPTSIT
GSYVSGVDAGTDPGVIEVTFGVGVNEQIDGSTLEISAVTSAGSIRWTCREGTDLPGKYLPTNCR
MNKIQQGFTLIELMIVVAIIGILAAIAIPAYQDYTIRAQVSEGLVLASGAKTALAEFYNSTGRFPGDNDSLGLQAPTSIT
GSYVSGVDAGTDPGVIEVTFGVGVNEQIDGSTLEISAVTSAGSIRWTCREGTDLPGKYLPTNCR
Nucleotide
Download Length: 435 bp
>NTDB_id=656566 MIH19_RS04945 WP_283164098.1 1039286..1039720(-) (pilE) [Marinobacter sp. M1C]
ATGAATAAAATTCAACAGGGTTTTACACTTATCGAACTGATGATCGTGGTAGCGATCATCGGTATTCTGGCAGCCATCGC
AATTCCGGCGTATCAGGATTACACCATTCGTGCGCAGGTTTCCGAAGGTTTGGTTCTGGCTTCTGGTGCCAAGACTGCCT
TGGCCGAATTTTACAACAGCACTGGGCGCTTCCCAGGCGATAACGACTCTCTTGGGCTGCAGGCACCCACAAGTATCACG
GGTTCTTACGTGTCCGGTGTAGATGCTGGCACCGACCCCGGTGTGATTGAGGTCACGTTTGGCGTAGGCGTTAACGAACA
GATTGACGGGTCGACTCTCGAAATCTCCGCAGTAACTTCTGCAGGCAGTATTAGATGGACTTGCCGGGAAGGTACGGACC
TTCCTGGCAAGTACCTACCTACTAACTGCCGTTAA
ATGAATAAAATTCAACAGGGTTTTACACTTATCGAACTGATGATCGTGGTAGCGATCATCGGTATTCTGGCAGCCATCGC
AATTCCGGCGTATCAGGATTACACCATTCGTGCGCAGGTTTCCGAAGGTTTGGTTCTGGCTTCTGGTGCCAAGACTGCCT
TGGCCGAATTTTACAACAGCACTGGGCGCTTCCCAGGCGATAACGACTCTCTTGGGCTGCAGGCACCCACAAGTATCACG
GGTTCTTACGTGTCCGGTGTAGATGCTGGCACCGACCCCGGTGTGATTGAGGTCACGTTTGGCGTAGGCGTTAACGAACA
GATTGACGGGTCGACTCTCGAAATCTCCGCAGTAACTTCTGCAGGCAGTATTAGATGGACTTGCCGGGAAGGTACGGACC
TTCCTGGCAAGTACCTACCTACTAACTGCCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilE | Neisseria gonorrhoeae MS11 |
44.72 |
100 |
0.5 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
44.375 |
100 |
0.493 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
35.979 |
100 |
0.472 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
41.212 |
100 |
0.472 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
46.429 |
97.222 |
0.451 |
| pilA2 | Legionella pneumophila str. Paris |
46.429 |
97.222 |
0.451 |
| pilA/pilA1 | Eikenella corrodens VA1 |
40.645 |
100 |
0.437 |
| pilA | Acinetobacter nosocomialis M2 |
43.478 |
95.833 |
0.417 |
| comP | Acinetobacter baylyi ADP1 |
39.865 |
100 |
0.41 |
| pilA | Acinetobacter baumannii strain A118 |
41.135 |
97.917 |
0.403 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
39.437 |
98.611 |
0.389 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
38.621 |
100 |
0.389 |
| pilA | Pseudomonas aeruginosa PAK |
34.437 |
100 |
0.361 |