Detailed information NTG0656485

Bioinformatically predicted

Overview

• Name: pilE
• Type: Machinery gene
• Locus tag: MIH16_RS04950
• Genome accession: NZ_CP092283
• Coordinates: 1040967..1041401 (-)
• Length: 144 a.a.
• NCBI ID: WP_283164098.1
• Uniprot ID: -
• Organism: Marinobacter sp. M4C
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1035967..1046401

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MIH16_RS04930 (MIH16_04930)	-	1037415..1038263 (-)	849	WP_249007814.1	glycosyltransferase family 2 protein	-
MIH16_RS04935 (MIH16_04935)	-	1038284..1040254 (-)	1971	WP_249007815.1	hypothetical protein	-
MIH16_RS04940 (MIH16_04940)	-	1040304..1040732 (-)	429	WP_283164097.1	pilin	-
MIH16_RS04950 (MIH16_04950)	pilE	1040967..1041401 (-)	435	WP_283164098.1	pilin	Machinery gene
MIH16_RS04960 (MIH16_04960)	-	1041769..1042005 (-)	237	WP_249007816.1	hypothetical protein	-
MIH16_RS04965 (MIH16_04965)	-	1042258..1042689 (-)	432	WP_249007817.1	type II toxin-antitoxin system HicB family antitoxin	-
MIH16_RS04970 (MIH16_04970)	-	1042730..1042912 (-)	183	WP_249007818.1	type II toxin-antitoxin system HicA family toxin	-
MIH16_RS04975 (MIH16_04975)	-	1043017..1043559 (-)	543	WP_249007819.1	hypothetical protein	-
MIH16_RS04980 (MIH16_04980)	-	1043694..1043960 (+)	267	WP_249007820.1	YlcI/YnfO family protein	-
MIH16_RS04985 (MIH16_04985)	-	1043957..1044256 (+)	300	WP_249007821.1	type II toxin-antitoxin system RelE/ParE family toxin	-
MIH16_RS22495	-	1044454..1044609 (+)	156	WP_349292903.1	type II toxin-antitoxin system RelE/ParE family toxin	-
MIH16_RS04995 (MIH16_04995)	-	1044611..1044913 (+)	303	WP_249007822.1	helix-turn-helix domain-containing protein	-
MIH16_RS05000 (MIH16_05000)	-	1045031..1045411 (+)	381	WP_249007823.1	helix-turn-helix transcriptional regulator	-
MIH16_RS05005 (MIH16_05005)	-	1045443..1045562 (-)	120	Protein_975	type II toxin-antitoxin system RelE/ParE family toxin	-
MIH16_RS05010 (MIH16_05010)	-	1045705..1045893 (+)	189	Protein_976	ATP-binding protein	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 15031.03 Da
• Isoelectric Point: 4.1546

>NTDB_id=656485 MIH16_RS04950 WP_283164098.1 1040967..1041401(-) (pilE) [Marinobacter sp. M4C]
MNKIQQGFTLIELMIVVAIIGILAAIAIPAYQDYTIRAQVSEGLVLASGAKTALAEFYNSTGRFPGDNDSLGLQAPTSIT
GSYVSGVDAGTDPGVIEVTFGVGVNEQIDGSTLEISAVTSAGSIRWTCREGTDLPGKYLPTNCR

Nucleotide

• Length: 435 bp

>NTDB_id=656485 MIH16_RS04950 WP_283164098.1 1040967..1041401(-) (pilE) [Marinobacter sp. M4C]
ATGAATAAAATTCAACAGGGTTTTACACTTATCGAACTGATGATCGTGGTAGCGATCATCGGTATTCTGGCAGCCATCGC
AATTCCGGCGTATCAGGATTACACCATTCGTGCGCAGGTTTCCGAAGGTTTGGTTCTGGCTTCTGGTGCCAAGACTGCCT
TGGCCGAATTTTACAACAGCACTGGGCGCTTCCCAGGCGATAACGACTCTCTTGGGCTGCAGGCACCCACAAGTATCACG
GGTTCTTACGTGTCCGGTGTAGATGCTGGCACCGACCCCGGTGTGATTGAGGTCACGTTTGGCGTAGGCGTTAACGAACA
GATTGACGGGTCGACTCTCGAAATCTCCGCAGTAACTTCTGCAGGCAGTATTAGATGGACTTGCCGGGAAGGTACGGACC
TTCCTGGCAAGTACCTACCTACTAACTGCCGTTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (37-144)

• Prokaryotic N-terminal methylation motif (N_methyl) (3-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria gonorrhoeae MS11	44.72	100	0.5
pilE	Neisseria gonorrhoeae strain FA1090	44.375	100	0.493
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	35.979	100	0.472
pilA	Ralstonia pseudosolanacearum GMI1000	41.212	100	0.472
pilA2	Legionella pneumophila strain ERS1305867	46.429	97.222	0.451
pilA2	Legionella pneumophila str. Paris	46.429	97.222	0.451
pilA/pilA1	Eikenella corrodens VA1	40.645	100	0.437
pilA	Acinetobacter nosocomialis M2	43.478	95.833	0.417
comP	Acinetobacter baylyi ADP1	39.865	100	0.41
pilA	Acinetobacter baumannii strain A118	41.135	97.917	0.403
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.437	98.611	0.389
pilA/pilAI	Pseudomonas stutzeri DSM 10701	38.621	100	0.389
pilA	Pseudomonas aeruginosa PAK	34.437	100	0.361