Detailed information NTG0642477

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: LZZ50_RS17395
• Genome accession: NZ_CP090441
• Coordinates: 4129285..4129710 (-)
• Length: 141 a.a.
• NCBI ID: WP_054592196.1
• Uniprot ID: -
• Organism: Xanthomonas arboricola strain YchA
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	4125424..4135694	4129285..4129710	within	0

Gene organization within MGE regions

Location: 4125424..4135694

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LZZ50_RS17380 (LZZ50_17380)	-	4125424..4126950 (-)	1527	WP_342370390.1	hypothetical protein	-
LZZ50_RS17385 (LZZ50_17385)	-	4126920..4127549 (-)	630	WP_245102989.1	hypothetical protein	-
LZZ50_RS17390 (LZZ50_17390)	-	4127560..4129149 (-)	1590	WP_245102991.1	phosphoethanolamine transferase	-
LZZ50_RS17395 (LZZ50_17395)	pilA2	4129285..4129710 (-)	426	WP_054592196.1	pilin	Machinery gene
LZZ50_RS17400 (LZZ50_17400)	pilC	4130064..4131323 (+)	1260	WP_184362404.1	type II secretion system F family protein	Machinery gene
LZZ50_RS17405 (LZZ50_17405)	-	4131330..4132193 (+)	864	WP_016849610.1	A24 family peptidase	-
LZZ50_RS17410 (LZZ50_17410)	coaE	4132207..4132830 (+)	624	WP_184608693.1	dephospho-CoA kinase	-
LZZ50_RS17415 (LZZ50_17415)	-	4132930..4133076 (+)	147	Protein_3410	SymE family type I addiction module toxin	-
LZZ50_RS17420 (LZZ50_17420)	-	4133188..4134522 (-)	1335	WP_016904089.1	HAMP domain-containing sensor histidine kinase	-
LZZ50_RS17425 (LZZ50_17425)	-	4134515..4135192 (-)	678	WP_006448355.1	response regulator transcription factor	-
LZZ50_RS17430 (LZZ50_17430)	-	4135224..4135694 (-)	471	WP_245102993.1	hypothetical protein	-

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 14385.63 Da
• Isoelectric Point: 9.0171

>NTDB_id=642477 LZZ50_RS17395 WP_054592196.1 4129285..4129710(-) (pilA2) [Xanthomonas arboricola strain YchA]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTTRAKLSEALTMSAPAKLAVTETASSLGGLAQVTAANSGYAFPGATK
YVSGVAITNATGVVTVTSTVPNATGTLLLTPTDVGGGQLKWTCSSAINTKYLPAECRNSGT

Nucleotide

• Length: 426 bp

>NTDB_id=642477 LZZ50_RS17395 WP_054592196.1 4129285..4129710(-) (pilA2) [Xanthomonas arboricola strain YchA]
ATGAAGAAGCAGCAAGGCTTTACACTTATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCACTCGCGCCAAGCTCAGTGAAGCGCTGACGATGTCGGCGCCTGCCAAGCTTGCGGTAA
CGGAGACTGCATCGTCGCTCGGCGGTCTCGCTCAGGTTACTGCGGCAAATTCGGGCTACGCATTCCCGGGTGCCACGAAG
TATGTCAGCGGCGTCGCCATCACCAATGCTACGGGCGTCGTCACTGTGACTTCCACCGTGCCGAACGCAACCGGTACCCT
CCTGCTGACCCCGACTGATGTCGGTGGTGGCCAGCTGAAGTGGACCTGCTCTTCCGCCATCAACACCAAGTACCTGCCGG
CGGAGTGCCGTAACTCGGGCACCTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

• Pilin (bacterial filament) (Pilin) (35-137)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila strain ERS1305867	53.676	96.454	0.518
pilA2	Legionella pneumophila str. Paris	53.676	96.454	0.518
pilA	Ralstonia pseudosolanacearum GMI1000	40.854	100	0.475
pilE	Neisseria gonorrhoeae MS11	40.741	100	0.468
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	35.135	100	0.461
pilE	Neisseria gonorrhoeae strain FA1090	39.264	100	0.454
comP	Acinetobacter baylyi ADP1	42.177	100	0.44
pilA/pilA1	Eikenella corrodens VA1	40.667	100	0.433
pilA/pilAI	Pseudomonas stutzeri DSM 10701	42.754	97.872	0.418
pilA/pilAII	Pseudomonas stutzeri DSM 10701	42.222	95.745	0.404
pilA	Pseudomonas aeruginosa PAK	36.364	100	0.397
pilA	Acinetobacter baumannii strain A118	37.5	100	0.383