NTDB

Overview

Name	comA	Type	Machinery gene
Locus tag	LPY97_RS37360	Genome accession	NZ_CP088007
Coordinates	8167142..8167357 (+)	Length	71 a.a.
NCBI ID	WP_231087277.1	Uniprot ID	-
Organism	Nocardia huaxiensis strain BCHNH01
Function	DNA uptake (predicted from homology) DNA binding and uptake

Genomic Context

Location: 8162142..8172357

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LPY97_RS37330 (LPY97_37330)	nadD	8162931..8163548 (+)	618	WP_231087276.1	nicotinate-nucleotide adenylyltransferase	-
LPY97_RS37335 (LPY97_37335)	rsfS	8163553..8163969 (+)	417	WP_181581348.1	ribosome silencing factor	-
LPY97_RS37340 (LPY97_37340)	-	8163978..8164628 (+)	651	WP_181586042.1	histidine phosphatase family protein	-
LPY97_RS37345 (LPY97_37345)	octT	8164618..8165508 (+)	891	WP_181581347.1	diglucosylglycerate octanoyltransferase	-
LPY97_RS37350 (LPY97_37350)	-	8165526..8166368 (+)	843	WP_181581346.1	DegV family protein	-
LPY97_RS37355 (LPY97_37355)	-	8166486..8167175 (+)	690	WP_231084464.1	hypothetical protein	-
LPY97_RS37360 (LPY97_37360)	comA	8167142..8167357 (+)	216	WP_231087277.1	ComEA family DNA-binding protein	Machinery gene
LPY97_RS37365 (LPY97_37365)	-	8167690..8169006 (+)	1317	WP_231084465.1	ComEC/Rec2 family competence protein	-
LPY97_RS37370 (LPY97_37370)	holA	8169060..8170031 (+)	972	WP_181581344.1	DNA polymerase III subunit delta	-
LPY97_RS37375 (LPY97_37375)	-	8170051..8170797 (-)	747	WP_231084466.1	LGFP repeat-containing protein	-
LPY97_RS37380 (LPY97_37380)	rpsT	8171024..8171287 (-)	264	WP_181581343.1	30S ribosomal protein S20	-

Sequence

Protein

Download Length: 71 a.a. Molecular weight: 7701.79 Da Isoelectric Point: 11.6549

                                >NTDB_id=632403 LPY97_RS37360 WP_231087277.1 8167142..8167357(+) (comA) [Nocardia huaxiensis strain BCHNH01]

MPRPTTPPTRVNLNTATEPELDALPGVGPVTARAILTWRTQHGRFTSIDQLAEVDGIGPSRLARLRNSVTI

Nucleotide

Download Length: 216 bp

                                >NTDB_id=632403 LPY97_RS37360 WP_231087277.1 8167142..8167357(+) (comA) [Nocardia huaxiensis strain BCHNH01]

ATCCCCCGCCCCACAACCCCTCCCACCCGCGTAAACCTCAACACCGCAACAGAACCCGAACTCGACGCCCTCCCCGGCGT

AGGCCCCGTCACCGCCCGCGCCATCCTCACCTGGCGCACCCAGCACGGCCGCTTCACCTCCATAGACCAACTCGCCGAAG

TAGACGGCATCGGCCCCTCCCGCCTCGCCCGCCTCCGCAACTCGGTGACGATATGA

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(10-70)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comA	Synechocystis sp. PCC 6803	46.053	100	0.493
comEA	Acinetobacter baylyi ADP1	40.541	100	0.423
comEA	Staphylococcus aureus MW2	45.455	92.958	0.423
comEA	Thermus thermophilus HB27	45.455	92.958	0.423
comEA	Staphylococcus aureus N315	45.455	92.958	0.423
comE	Neisseria gonorrhoeae MS11	49.18	85.915	0.423
comE	Neisseria gonorrhoeae MS11	49.18	85.915	0.423
comE	Neisseria gonorrhoeae MS11	49.18	85.915	0.423
comE	Neisseria gonorrhoeae MS11	49.18	85.915	0.423
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	47.541	85.915	0.408
comEA	Vibrio cholerae strain A1552	45.763	83.099	0.38
comEA	Vibrio cholerae C6706	45.763	83.099	0.38
comEA/comE1	Glaesserella parasuis strain SC1401	43.548	87.324	0.38
comEA	Bacillus subtilis subsp. subtilis str. 168	42.623	85.915	0.366
comE1/comEA	Haemophilus influenzae Rd KW20	38.806	94.366	0.366

Detailed information NTG0632403