NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	K6976_RS00765	Genome accession	NZ_CP082202
Coordinates	123432..123713 (+)	Length	93 a.a.
NCBI ID	WP_222759615.1	Uniprot ID	-
Organism	Streptococcus suis strain SS389
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 118432..128713

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
K6976_RS00745 (K6976_00745)	-	120093..120467 (+)	375	WP_024385120.1	DUF1033 family protein	-
K6976_RS00750 (K6976_00750)	-	120495..121445 (-)	951	WP_222759611.1	S66 peptidase family protein	-
K6976_RS00755 (K6976_00755)	comYA	121531..122481 (+)	951	WP_222759613.1	competence type IV pilus ATPase ComGA	Machinery gene
K6976_RS00760 (K6976_00760)	comYB	122393..123430 (+)	1038	WP_261988003.1	competence type IV pilus assembly protein ComGB	Machinery gene
K6976_RS00765 (K6976_00765)	comYC	123432..123713 (+)	282	WP_222759615.1	competence type IV pilus major pilin ComGC	Machinery gene
K6976_RS00770 (K6976_00770)	comGD	123694..124101 (+)	408	WP_222759617.1	competence type IV pilus minor pilin ComGD	-
K6976_RS00775 (K6976_00775)	comYE	124073..124366 (+)	294	WP_172099849.1	competence type IV pilus minor pilin ComGE	Machinery gene
K6976_RS00780 (K6976_00780)	comGF/cglF	124353..124787 (+)	435	WP_222759618.1	competence type IV pilus minor pilin ComGF	Machinery gene
K6976_RS00785 (K6976_00785)	comGG	124765..125283 (+)	519	WP_222759619.1	competence type IV pilus minor pilin ComGG	-
K6976_RS00790 (K6976_00790)	comYH	125337..126290 (+)	954	WP_222759621.1	class I SAM-dependent methyltransferase	Machinery gene
K6976_RS00795 (K6976_00795)	-	126340..127527 (+)	1188	WP_222759623.1	acetate kinase	-
K6976_RS00800 (K6976_00800)	-	127956..128507 (+)	552	WP_105127996.1	folate family ECF transporter S component	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10485.50 Da Isoelectric Point: 9.6588

                                >NTDB_id=599863 K6976_RS00765 WP_222759615.1 123432..123713(+) (comYC) [Streptococcus suis strain SS389]

MKKLIEKKVKAFTLVEMLVVLGIISLLLLLFVPNLSQQKDAVQEKGNAAVVKVVESQMELYELKYEKKATVEDLQQAGYI

TAKQAEQYVTAKK

Nucleotide

Download Length: 282 bp

                                >NTDB_id=599863 K6976_RS00765 WP_222759615.1 123432..123713(+) (comYC) [Streptococcus suis strain SS389]

ATGAAAAAATTAATTGAAAAGAAGGTAAAAGCGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGCATCATTAGTCTGCT

CTTGCTCCTTTTTGTGCCAAATTTGAGCCAACAAAAGGATGCTGTTCAAGAGAAAGGAAATGCTGCCGTTGTCAAAGTAG

TGGAGAGCCAGATGGAGCTCTATGAATTGAAGTATGAGAAGAAGGCAACGGTGGAGGACTTGCAACAGGCTGGTTATATT

ACAGCAAAACAAGCGGAGCAGTATGTTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(7-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus suis isolate S10	81.72	100	0.817
comYC	Streptococcus gordonii str. Challis substr. CH1	66.292	95.699	0.634
comGC/cglC	Streptococcus mitis NCTC 12261	63.043	98.925	0.624
comGC/cglC	Streptococcus mitis SK321	63.043	98.925	0.624
comYC	Streptococcus mutans UA159	61.364	94.624	0.581
comYC	Streptococcus mutans UA140	61.364	94.624	0.581
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	87.097	0.581
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	87.097	0.581
comGC/cglC	Streptococcus pneumoniae R6	66.667	87.097	0.581
comGC/cglC	Streptococcus pneumoniae D39	66.667	87.097	0.581
comGC	Lactococcus lactis subsp. cremoris KW2	59.091	94.624	0.559
comGC	Staphylococcus aureus MW2	50.667	80.645	0.409
comGC	Staphylococcus aureus N315	50.667	80.645	0.409

Detailed information NTG0599863