NTDB

Overview

Name	comGC/cglC	Type	Machinery gene
Locus tag	LPB404_RS01910	Genome accession	NZ_CP079821
Coordinates	374486..374803 (+)	Length	105 a.a.
NCBI ID	WP_219074903.1	Uniprot ID	-
Organism	Streptococcus rubneri strain LPB0404
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 369486..379803

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LPB404_RS01895 (LPB404_01895)	-	372102..372479 (+)	378	WP_219074901.1	DUF1033 family protein	-
LPB404_RS01900 (LPB404_01900)	comYA	372584..373543 (+)	960	WP_219074902.1	competence type IV pilus ATPase ComGA	Machinery gene
LPB404_RS01905 (LPB404_01905)	comYB	373467..374489 (+)	1023	WP_257573088.1	competence type IV pilus assembly protein ComGB	Machinery gene
LPB404_RS01910 (LPB404_01910)	comGC/cglC	374486..374803 (+)	318	WP_219074903.1	competence type IV pilus major pilin ComGC	Machinery gene
LPB404_RS01915 (LPB404_01915)	comGD/cglD	374793..375197 (+)	405	WP_219075204.1	competence type IV pilus minor pilin ComGD	Machinery gene
LPB404_RS01920 (LPB404_01920)	comGE	375163..375456 (+)	294	WP_219074904.1	competence type IV pilus minor pilin ComGE	-
LPB404_RS01925 (LPB404_01925)	comGF/cglF	375440..375892 (+)	453	WP_219075203.1	competence type IV pilus minor pilin ComGF	Machinery gene
LPB404_RS01930 (LPB404_01930)	comGG	375921..376304 (+)	384	WP_374030902.1	competence type IV pilus minor pilin ComGG	-
LPB404_RS01935 (LPB404_01935)	comYH	376336..377289 (+)	954	WP_120701351.1	class I SAM-dependent methyltransferase	Machinery gene
LPB404_RS01940 (LPB404_01940)	-	377338..378534 (+)	1197	WP_219074906.1	acetate kinase	-
LPB404_RS01945 (LPB404_01945)	-	378687..379361 (+)	675	WP_244917016.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11719.65 Da Isoelectric Point: 9.8248

                                >NTDB_id=589730 LPB404_RS01910 WP_219074903.1 374486..374803(+) (comGC/cglC) [Streptococcus rubneri strain LPB0404]

MKSLRTLKVKAFTLIEMLVVLLIISVLLLLFVPNLTKQKDSVTDTGNRAVVKVVESQAELYELNHQNEKASLSKLVAEGQ

ITQKQAEAYRSHYVKNAGDHRAVAD

Nucleotide

Download Length: 318 bp

                                >NTDB_id=589730 LPB404_RS01910 WP_219074903.1 374486..374803(+) (comGC/cglC) [Streptococcus rubneri strain LPB0404]

ATGAAATCATTGCGTACACTCAAAGTAAAAGCTTTTACGCTGATTGAAATGTTAGTTGTTTTGCTCATTATCAGTGTTCT

CCTCTTGCTCTTTGTTCCGAACTTGACCAAGCAGAAAGATTCGGTAACGGATACAGGAAACCGAGCAGTTGTCAAAGTAG

TGGAGAGCCAGGCTGAGCTCTATGAACTCAATCATCAGAATGAAAAAGCCAGTCTTTCTAAGCTTGTCGCAGAAGGACAA

ATCACTCAAAAACAAGCAGAAGCCTACCGTTCTCACTATGTGAAGAATGCAGGTGATCACCGTGCGGTTGCAGATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC/cglC	Streptococcus mitis SK321	69.524	100	0.695
comYC	Streptococcus gordonii str. Challis substr. CH1	68.571	100	0.686
comYC	Streptococcus mutans UA140	67.619	100	0.676
comYC	Streptococcus mutans UA159	67.619	100	0.676
comGC/cglC	Streptococcus pneumoniae R6	66.667	100	0.667
comGC/cglC	Streptococcus pneumoniae D39	66.667	100	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	100	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	66.667	100	0.667
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	100	0.667
comGC	Lactococcus lactis subsp. cremoris KW2	61.224	93.333	0.571
comYC	Streptococcus suis isolate S10	62.637	86.667	0.543
comGC	Staphylococcus aureus N315	51.282	74.286	0.381
comGC	Staphylococcus aureus MW2	51.282	74.286	0.381

Detailed information NTG0589730