Detailed information NTG0058609

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: TL13_RS00790
• Genome accession: NC_021213
• Coordinates: 128409..128690 (+)
• Length: 93 a.a.
• NCBI ID: WP_015646272.1
• Uniprot ID: -
• Organism: Streptococcus suis TL13
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 123409..133690

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
TL13_RS00770 (TL13_0153)	-	125072..125437 (+)	366	WP_014637310.1	DUF1033 family protein	-
TL13_RS00775 (TL13_0154)	-	125472..126422 (-)	951	WP_014637311.1	S66 peptidase family protein	-
TL13_RS00780 (TL13_0155)	comYA	126508..127458 (+)	951	WP_015646270.1	competence type IV pilus ATPase ComGA	Machinery gene
TL13_RS00785 (TL13_0156)	comYB	127370..128407 (+)	1038	WP_051089044.1	competence type IV pilus assembly protein ComGB	Machinery gene
TL13_RS00790 (TL13_0157)	comYC	128409..128690 (+)	282	WP_015646272.1	competence type IV pilus major pilin ComGC	Machinery gene
TL13_RS00795 (TL13_0158)	comGD	128671..129078 (+)	408	WP_015646273.1	competence type IV pilus minor pilin ComGD	-
TL13_RS00800 (TL13_0159)	comYE	129050..129343 (+)	294	WP_024401507.1	competence type IV pilus minor pilin ComGE	Machinery gene
TL13_RS00805 (TL13_0160)	comGF/cglF	129330..129764 (+)	435	WP_015646275.1	competence type IV pilus minor pilin ComGF	Machinery gene
TL13_RS00810 (TL13_0161)	comGG	129742..130155 (+)	414	WP_015646276.1	competence type IV pilus minor pilin ComGG	-
TL13_RS00815 (TL13_0162)	-	131334..132008 (-)	675	WP_015646277.1	head maturation protease, ClpP-related	-
TL13_RS00820 (TL13_0163)	-	131998..132489 (-)	492	WP_015646278.1	hypothetical protein	-
TL13_RS00825 (TL13_0164)	-	132502..133017 (-)	516	WP_041179361.1	hypothetical protein	-
TL13_RS10750 (TL13_0165)	-	133165..133332 (-)	168	WP_015646280.1	hypothetical protein	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10488.47 Da
• Isoelectric Point: 6.3464

>NTDB_id=58609 TL13_RS00790 WP_015646272.1 128409..128690(+) (comYC) [Streptococcus suis TL13]
MKKLIEMKVKAFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKKGDAAVVKVVESQMELYELEYDKEATVEDLQKAGYI
TPKQAEQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=58609 TL13_RS00790 WP_015646272.1 128409..128690(+) (comYC) [Streptococcus suis TL13]
ATGAAAAAATTAATTGAAATGAAGGTAAAAGCGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGAATTATCAGCCTGCT
CTTGCTCCTCTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCGGCAGTTGTTAAGGTAG
TAGAGAGTCAAATGGAGCTCTATGAATTGGAATATGATAAGGAAGCAACGGTGGAGGACTTGCAAAAGGCTGGTTATATT
ACACCAAAACAAGCGGAGCAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	90.323	100	0.903
comGC/cglC	Streptococcus pneumoniae TIGR4	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae Rx1	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae D39	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae R6	61.957	98.925	0.613
comGC/cglC	Streptococcus mitis NCTC 12261	61.957	98.925	0.613
comGC/cglC	Streptococcus mitis SK321	61.957	98.925	0.613
comYC	Streptococcus gordonii str. Challis substr. CH1	62.921	95.699	0.602
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	57.955	94.624	0.548
comGC	Staphylococcus aureus MW2	50	79.57	0.398
comGC	Staphylococcus aureus N315	50	79.57	0.398
comGC	Bacillus subtilis subsp. subtilis str. 168	45.333	80.645	0.366