Detailed information NTG0553304

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: J7T61_RS08850
• Genome accession: NZ_CP072441
• Coordinates: 1685146..1685472 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain S24728
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1680146..1690472

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7T61_RS08810	-	1680413..1680751 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
J7T61_RS08815 (J7T61_08750)	-	1681081..1681278 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
J7T61_RS08820 (J7T61_08755)	-	1681527..1682720 (-)	1194	WP_372429425.1	acetate kinase	-
J7T61_RS08825 (J7T61_08760)	comYH	1682776..1683732 (-)	957	WP_084831205.1	class I SAM-dependent methyltransferase	Machinery gene
J7T61_RS08830 (J7T61_08765)	comGG	1683777..1684094 (-)	318	WP_082309152.1	competence type IV pilus minor pilin ComGG	-
J7T61_RS08835 (J7T61_08770)	comYF	1684072..1684509 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7T61_RS08840 (J7T61_08775)	comGE	1684493..1684786 (-)	294	WP_082309154.1	competence type IV pilus minor pilin ComGE	-
J7T61_RS08845 (J7T61_08780)	comYD	1684758..1685186 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7T61_RS08850 (J7T61_08785)	comYC	1685146..1685472 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7T61_RS08855 (J7T61_08790)	comGB	1685469..1686568 (-)	1100	Protein_1687	competence type IV pilus assembly protein ComGB	-
J7T61_RS08860 (J7T61_08795)	comGA/cglA/cilD	1686450..1687391 (-)	942	WP_071417491.1	competence type IV pilus ATPase ComGA	Machinery gene
J7T61_RS08865 (J7T61_08800)	-	1687472..1687834 (-)	363	WP_014622006.1	DUF1033 family protein	-
J7T61_RS08870 (J7T61_08805)	-	1688104..1689352 (+)	1249	Protein_1690	ISL3 family transposase	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=553304 J7T61_RS08850 WP_002946126.1 1685146..1685472(-) (comYC) [Streptococcus thermophilus strain S24728]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=553304 J7T61_RS08850 WP_002946126.1 1685146..1685472(-) (comYC) [Streptococcus thermophilus strain S24728]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATATAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361