Detailed information NTG0553303

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: J7T61_RS08845
• Genome accession: NZ_CP072441
• Coordinates: 1684758..1685186 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24728
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1679758..1690186

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7T61_RS08805 (J7T61_08740)	-	1679896..1680339 (-)	444	WP_041829335.1	hypothetical protein	-
J7T61_RS08810	-	1680413..1680751 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
J7T61_RS08815 (J7T61_08750)	-	1681081..1681278 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
J7T61_RS08820 (J7T61_08755)	-	1681527..1682720 (-)	1194	WP_372429425.1	acetate kinase	-
J7T61_RS08825 (J7T61_08760)	comYH	1682776..1683732 (-)	957	WP_084831205.1	class I SAM-dependent methyltransferase	Machinery gene
J7T61_RS08830 (J7T61_08765)	comGG	1683777..1684094 (-)	318	WP_082309152.1	competence type IV pilus minor pilin ComGG	-
J7T61_RS08835 (J7T61_08770)	comYF	1684072..1684509 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7T61_RS08840 (J7T61_08775)	comGE	1684493..1684786 (-)	294	WP_082309154.1	competence type IV pilus minor pilin ComGE	-
J7T61_RS08845 (J7T61_08780)	comYD	1684758..1685186 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7T61_RS08850 (J7T61_08785)	comYC	1685146..1685472 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7T61_RS08855 (J7T61_08790)	comGB	1685469..1686568 (-)	1100	Protein_1687	competence type IV pilus assembly protein ComGB	-
J7T61_RS08860 (J7T61_08795)	comGA/cglA/cilD	1686450..1687391 (-)	942	WP_071417491.1	competence type IV pilus ATPase ComGA	Machinery gene
J7T61_RS08865 (J7T61_08800)	-	1687472..1687834 (-)	363	WP_014622006.1	DUF1033 family protein	-
J7T61_RS08870 (J7T61_08805)	-	1688104..1689352 (+)	1249	Protein_1690	ISL3 family transposase	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=553303 J7T61_RS08845 WP_011226626.1 1684758..1685186(-) (comYD) [Streptococcus thermophilus strain S24728]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=553303 J7T61_RS08845 WP_011226626.1 1684758..1685186(-) (comYD) [Streptococcus thermophilus strain S24728]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTAGTAATGGAAGATCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCTAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38