Detailed information
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | JH299_RS16210 | Genome accession | NZ_CP066928 |
| Coordinates | 3657028..3657435 (-) | Length | 135 a.a. |
| NCBI ID | WP_076037052.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. incanae strain CFBP1371 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3647635..3690119 | 3657028..3657435 | within | 0 |
Gene organization within MGE regions
Location: 3647635..3690119
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JH299_RS16170 (JH299_16130) | - | 3647635..3648045 (-) | 411 | WP_029628876.1 | DNA-binding protein | - |
| JH299_RS16175 (JH299_16135) | sucD | 3648149..3649024 (-) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| JH299_RS16180 (JH299_16140) | sucC | 3649049..3650218 (-) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| JH299_RS16185 (JH299_16145) | - | 3650452..3652062 (+) | 1611 | WP_076037049.1 | HAMP domain-containing sensor histidine kinase | - |
| JH299_RS16190 (JH299_16150) | pilR | 3652271..3653665 (+) | 1395 | WP_043921909.1 | sigma-54 dependent transcriptional regulator | Regulator |
| JH299_RS16195 (JH299_16155) | - | 3653863..3654219 (+) | 357 | WP_139328384.1 | hypothetical protein | - |
| JH299_RS16200 (JH299_16160) | - | 3654219..3654956 (+) | 738 | WP_070690009.1 | zeta toxin family protein | - |
| JH299_RS16205 (JH299_16165) | pilB | 3655139..3656845 (-) | 1707 | WP_175611860.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| JH299_RS16210 (JH299_16170) | pilA/pilAI | 3657028..3657435 (-) | 408 | WP_076037052.1 | pilin | Machinery gene |
| JH299_RS16215 (JH299_16175) | pilC | 3657780..3659036 (+) | 1257 | WP_076037882.1 | type II secretion system F family protein | Machinery gene |
| JH299_RS16220 (JH299_16180) | - | 3659043..3659906 (+) | 864 | WP_040940797.1 | A24 family peptidase | - |
| JH299_RS16225 (JH299_16185) | coaE | 3659920..3660543 (+) | 624 | WP_076037053.1 | dephospho-CoA kinase | - |
| JH299_RS16230 (JH299_16190) | - | 3661072..3661473 (+) | 402 | WP_076037054.1 | SymE family type I addiction module toxin | - |
| JH299_RS16235 (JH299_16195) | - | 3661549..3661839 (+) | 291 | WP_014508712.1 | DUF1778 domain-containing protein | - |
| JH299_RS16240 (JH299_16200) | - | 3661836..3662327 (+) | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | - |
| JH299_RS16245 (JH299_16205) | - | 3662470..3663804 (-) | 1335 | WP_019237347.1 | HAMP domain-containing sensor histidine kinase | - |
| JH299_RS16250 (JH299_16210) | - | 3663797..3664474 (-) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| JH299_RS16255 (JH299_16215) | rimK | 3665124..3665999 (-) | 876 | WP_076037055.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| JH299_RS16260 (JH299_16220) | glgX | 3666492..3668621 (+) | 2130 | WP_016945001.1 | glycogen debranching protein GlgX | - |
| JH299_RS16265 (JH299_16225) | - | 3669152..3669544 (-) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| JH299_RS16270 (JH299_16230) | - | 3669635..3670030 (-) | 396 | WP_011038225.1 | hypothetical protein | - |
| JH299_RS16275 (JH299_16235) | - | 3670215..3670361 (-) | 147 | WP_076037056.1 | hypothetical protein | - |
| JH299_RS16280 | - | 3670479..3670820 (-) | 342 | WP_228438057.1 | hypothetical protein | - |
| JH299_RS16285 (JH299_16245) | - | 3670953..3671324 (-) | 372 | WP_076037057.1 | hypothetical protein | - |
| JH299_RS16290 (JH299_16250) | - | 3672027..3672368 (+) | 342 | WP_070689991.1 | hypothetical protein | - |
| JH299_RS16295 (JH299_16255) | - | 3672433..3672714 (+) | 282 | WP_076037058.1 | DUF6516 family protein | - |
| JH299_RS16300 (JH299_16260) | - | 3672722..3673090 (+) | 369 | WP_065628137.1 | transcriptional regulator | - |
| JH299_RS16305 (JH299_16265) | - | 3673162..3673953 (-) | 792 | WP_076037059.1 | hypothetical protein | - |
| JH299_RS16310 (JH299_16270) | - | 3674069..3675171 (+) | 1103 | WP_100101058.1 | IS3-like element IS1404 family transposase | - |
| JH299_RS16315 (JH299_16275) | - | 3675330..3675983 (-) | 654 | WP_147309026.1 | hypothetical protein | - |
| JH299_RS16320 (JH299_16280) | - | 3676601..3676945 (+) | 345 | WP_228438129.1 | hypothetical protein | - |
| JH299_RS16325 (JH299_16285) | - | 3676942..3677358 (+) | 417 | WP_076037060.1 | hypothetical protein | - |
| JH299_RS16330 (JH299_16290) | xopAE | 3677568..3679199 (-) | 1632 | WP_076037061.1 | type III secretion system effector XopAE | - |
| JH299_RS16335 (JH299_16295) | - | 3679782..3680060 (+) | 279 | WP_139328385.1 | hypothetical protein | - |
| JH299_RS16340 (JH299_16300) | - | 3680494..3680718 (-) | 225 | WP_175611669.1 | hypothetical protein | - |
| JH299_RS16345 (JH299_16305) | - | 3681263..3682663 (+) | 1401 | WP_076037063.1 | site-specific integrase | - |
| JH299_RS16350 (JH299_16310) | - | 3682865..3683338 (+) | 474 | WP_139328386.1 | hypothetical protein | - |
| JH299_RS16355 (JH299_16315) | - | 3683465..3684337 (+) | 873 | WP_139328387.1 | hypothetical protein | - |
| JH299_RS16360 (JH299_16320) | - | 3684573..3684896 (-) | 324 | WP_175611861.1 | helix-turn-helix transcriptional regulator | - |
| JH299_RS16370 (JH299_16330) | - | 3686939..3687737 (+) | 799 | WP_100097398.1 | IS5 family transposase | - |
| JH299_RS16375 (JH299_16335) | - | 3688257..3688481 (+) | 225 | WP_139328388.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 135 a.a. Molecular weight: 13971.10 Da Isoelectric Point: 8.4701
>NTDB_id=523278 JH299_RS16210 WP_076037052.1 3657028..3657435(-) (pilA/pilAI) [Xanthomonas campestris pv. incanae strain CFBP1371]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYVVKSQAASALAEITPGKVGFEQATNEGKTPSTLSTDAGYIGVGPTTS
YCGVTVTATTIVCATAGGNATKFNGKKLTWTRDAATGLWACSSDLDAKYKPGKCT
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYVVKSQAASALAEITPGKVGFEQATNEGKTPSTLSTDAGYIGVGPTTS
YCGVTVTATTIVCATAGGNATKFNGKKLTWTRDAATGLWACSSDLDAKYKPGKCT
Nucleotide
Download Length: 408 bp
>NTDB_id=523278 JH299_RS16210 WP_076037052.1 3657028..3657435(-) (pilA/pilAI) [Xanthomonas campestris pv. incanae strain CFBP1371]
ATGAAGAAGCAACAAGGTTTTACGCTGATCGAATTGATGATCGTTGTGGCAATTATCGCGATCTTGGCCGCGATCGCGCT
GCCGGCTTATCAGGACTATGTAGTGAAGTCGCAGGCAGCATCCGCCCTGGCTGAAATCACTCCTGGCAAAGTTGGCTTCG
AGCAGGCGACCAATGAAGGCAAGACTCCCAGCACCCTTTCTACGGACGCGGGTTATATCGGAGTCGGTCCGACCACTTCT
TATTGTGGTGTCACCGTGACTGCTACCACCATCGTCTGCGCTACTGCTGGCGGCAACGCAACTAAGTTCAACGGTAAGAA
ATTGACCTGGACCCGTGATGCAGCAACTGGTCTGTGGGCCTGCTCGTCCGACCTGGATGCGAAGTACAAGCCTGGCAAGT
GCACCTAA
ATGAAGAAGCAACAAGGTTTTACGCTGATCGAATTGATGATCGTTGTGGCAATTATCGCGATCTTGGCCGCGATCGCGCT
GCCGGCTTATCAGGACTATGTAGTGAAGTCGCAGGCAGCATCCGCCCTGGCTGAAATCACTCCTGGCAAAGTTGGCTTCG
AGCAGGCGACCAATGAAGGCAAGACTCCCAGCACCCTTTCTACGGACGCGGGTTATATCGGAGTCGGTCCGACCACTTCT
TATTGTGGTGTCACCGTGACTGCTACCACCATCGTCTGCGCTACTGCTGGCGGCAACGCAACTAAGTTCAACGGTAAGAA
ATTGACCTGGACCCGTGATGCAGCAACTGGTCTGTGGGCCTGCTCGTCCGACCTGGATGCGAAGTACAAGCCTGGCAAGT
GCACCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
68.889 |
100 |
0.689 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
62.406 |
98.519 |
0.615 |
| pilA | Pseudomonas aeruginosa PAK |
42.581 |
100 |
0.489 |
| pilA | Acinetobacter baumannii strain A118 |
44.056 |
100 |
0.467 |
| pilA | Vibrio cholerae C6706 |
42.254 |
100 |
0.444 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
42.254 |
100 |
0.444 |
| pilA | Vibrio cholerae strain A1552 |
42.254 |
100 |
0.444 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
44.697 |
97.778 |
0.437 |
| comP | Acinetobacter baylyi ADP1 |
38.776 |
100 |
0.422 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
35.443 |
100 |
0.415 |
| pilE | Neisseria gonorrhoeae MS11 |
42.52 |
94.074 |
0.4 |
| pilA2 | Legionella pneumophila str. Paris |
37.226 |
100 |
0.378 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
37.226 |
100 |
0.378 |