NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	IGS65_RS08720	Genome accession	NZ_CP066294
Coordinates	1802246..1802560 (+)	Length	104 a.a.
NCBI ID	WP_002263437.1	Uniprot ID	-
Organism	Streptococcus mutans strain 27-3
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1797246..1807560

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IGS65_RS08705 (IGS65_008705)	-	1799823..1800206 (+)	384	WP_002264248.1	DUF1033 family protein	-
IGS65_RS08710 (IGS65_008710)	comYA	1800338..1801279 (+)	942	WP_192072412.1	competence type IV pilus ATPase ComGA	Machinery gene
IGS65_RS08715 (IGS65_008715)	comYB	1801215..1802246 (+)	1032	WP_280517816.1	competence type IV pilus assembly protein ComGB	Machinery gene
IGS65_RS08720 (IGS65_008720)	comYC	1802246..1802560 (+)	315	WP_002263437.1	competence type IV pilus major pilin ComGC	Machinery gene
IGS65_RS08725 (IGS65_008725)	comYD	1802547..1802951 (+)	405	WP_002263438.1	competence type IV pilus minor pilin ComGD	Machinery gene
IGS65_RS08730 (IGS65_008730)	comYE	1802923..1803216 (+)	294	WP_002263439.1	competence type IV pilus minor pilin ComGE	Machinery gene
IGS65_RS08735 (IGS65_008735)	comYF	1803203..1803637 (+)	435	WP_002263440.1	competence type IV pilus minor pilin ComGF	Machinery gene
IGS65_RS08740 (IGS65_008740)	comYG	1803615..1804004 (+)	390	WP_002263441.1	competence type IV pilus minor pilin ComGG	Machinery gene
IGS65_RS08745 (IGS65_008745)	comYH	1804059..1805012 (+)	954	WP_002264244.1	class I SAM-dependent methyltransferase	Machinery gene
IGS65_RS08750 (IGS65_008750)	-	1805071..1806270 (+)	1200	WP_002263443.1	acetate kinase	-
IGS65_RS08755 (IGS65_008755)	-	1806815..1807060 (+)	246	WP_002263444.1	helix-turn-helix transcriptional regulator	-
IGS65_RS08760 (IGS65_008760)	-	1807029..1807469 (+)	441	WP_002263445.1	hypothetical protein	-

Sequence

Protein

Download Length: 104 a.a. Molecular weight: 11591.60 Da Isoelectric Point: 10.2206

                                >NTDB_id=519157 IGS65_RS08720 WP_002263437.1 1802246..1802560(+) (comYC) [Streptococcus mutans strain 27-3]

MKKIKRVSVRAFTLIEMLVVLLIISILLLLFVPNLTKQKDKVKDTGGSAVVKVVESQAELYELNKTDSATLSKLVASGDI

TQEQANSYKDYYAKHPSKTRHVAN

Nucleotide

Download Length: 315 bp

                                >NTDB_id=519157 IGS65_RS08720 WP_002263437.1 1802246..1802560(+) (comYC) [Streptococcus mutans strain 27-3]

ATGAAAAAGATCAAGAGAGTCAGTGTACGGGCTTTTACGCTTATAGAAATGTTAGTAGTTCTTCTCATTATTAGTATTCT

TTTACTATTATTTGTTCCTAATTTAACTAAGCAAAAAGATAAGGTAAAAGATACTGGCGGTTCTGCCGTGGTTAAAGTTG

TAGAAAGTCAGGCTGAGCTTTATGAGCTTAATAAAACCGATTCTGCTACTCTTTCTAAATTAGTAGCTAGTGGTGATATT

ACACAAGAACAGGCAAATTCATACAAGGATTACTATGCAAAACACCCAAGTAAAACACGGCATGTCGCGAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(9-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus mutans UA140	100	100	1
comYC	Streptococcus mutans UA159	100	100	1
comYC	Streptococcus gordonii str. Challis substr. CH1	71.429	100	0.721
comGC/cglC	Streptococcus mitis SK321	66.667	95.192	0.635
comGC/cglC	Streptococcus mitis NCTC 12261	69.565	88.462	0.615
comGC/cglC	Streptococcus pneumoniae R6	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae Rx1	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae D39	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae TIGR4	63.636	95.192	0.606
comGC	Lactococcus lactis subsp. cremoris KW2	55.446	97.115	0.538
comYC	Streptococcus suis isolate S10	60.227	84.615	0.51

Detailed information NTG0519157