NTDB

Overview

Name	pilA2	Type	Machinery gene
Locus tag	I6N98_RS04315	Genome accession	NZ_CP066167
Coordinates	944169..944600 (+)	Length	143 a.a.
NCBI ID	WP_198570571.1	Uniprot ID	A0A7T4UQV7
Organism	Spongiibacter nanhainus strain csc3.9
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	944651..954540	944169..944600	flank	51

Gene organization within MGE regions

Location: 944169..954540

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
I6N98_RS04315 (I6N98_04315)	pilA2	944169..944600 (+)	432	WP_198570571.1	pilin	Machinery gene
I6N98_RS04320 (I6N98_04320)	-	944651..946606 (+)	1956	WP_198570572.1	hypothetical protein	-
I6N98_RS04325 (I6N98_04325)	-	946603..947457 (+)	855	WP_198570573.1	glycosyltransferase family 2 protein	-
I6N98_RS04330 (I6N98_04330)	-	947528..949216 (+)	1689	WP_198570574.1	ATP-binding cassette domain-containing protein	-
I6N98_RS04335 (I6N98_04335)	-	949431..950465 (+)	1035	WP_198570575.1	glycosyltransferase	-
I6N98_RS04340 (I6N98_04340)	-	950636..952162 (+)	1527	WP_198570576.1	stealth conserved region 3 domain-containing protein	-
I6N98_RS04345 (I6N98_04345)	-	952180..953205 (-)	1026	WP_198571544.1	stealth family protein	-
I6N98_RS04350 (I6N98_04350)	-	953329..954540 (-)	1212	WP_198570577.1	glycosyltransferase	-

Sequence

Protein

Download Length: 143 a.a. Molecular weight: 15056.09 Da Isoelectric Point: 4.7526

                                >NTDB_id=517931 I6N98_RS04315 WP_198570571.1 944169..944600(+) (pilA2) [Spongiibacter nanhainus strain csc3.9]

MKKTQQGFTLIELMIVVAIIGILAAVALPAYQDYTTRSKISEGLTLASAAKTAVSEHAMTRNTYPADNDAAGYVAPDTQY

VDDIQIANTGVVTITYKTAAGVAAGEDELELSPTTNASGVQWVCKQPAANAVLAKYLPSNCRS

Nucleotide

Download Length: 432 bp

                                >NTDB_id=517931 I6N98_RS04315 WP_198570571.1 944169..944600(+) (pilA2) [Spongiibacter nanhainus strain csc3.9]

ATGAAGAAGACACAACAAGGTTTTACGCTGATCGAATTGATGATCGTTGTAGCGATCATTGGTATTTTGGCGGCGGTTGC

ACTGCCTGCCTACCAGGATTACACAACTCGCTCAAAGATTTCTGAAGGTTTGACGCTGGCTTCAGCTGCCAAAACTGCGG

TATCTGAGCACGCGATGACGCGCAACACTTACCCAGCAGACAACGACGCGGCGGGTTATGTTGCTCCGGACACTCAGTAC

GTTGACGATATTCAAATTGCTAACACTGGGGTGGTCACTATCACTTACAAGACTGCCGCAGGTGTTGCTGCTGGTGAAGA

TGAGCTGGAGCTCTCTCCGACCACCAATGCTTCCGGTGTGCAGTGGGTATGTAAGCAGCCTGCGGCCAATGCAGTCCTTG

CAAAATACCTGCCTTCTAACTGCCGCTCATAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(36-142)

Prokaryotic N-terminal methylation motif (N_methyl)

(3-28)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A7T4UQV7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA2	Legionella pneumophila str. Paris	55.714	97.902	0.545
pilA2	Legionella pneumophila strain ERS1305867	55.714	97.902	0.545
pilA	Ralstonia pseudosolanacearum GMI1000	43.114	100	0.503
pilE	Neisseria gonorrhoeae MS11	42.236	100	0.476
pilE	Neisseria gonorrhoeae strain FA1090	42.767	100	0.476
pilA/pilA1	Eikenella corrodens VA1	41.176	100	0.441
comP	Acinetobacter baylyi ADP1	40.132	100	0.427
pilA/pilAI	Pseudomonas stutzeri DSM 10701	41.844	98.601	0.413
pilA	Vibrio cholerae strain A1552	38.667	100	0.406
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	38.667	100	0.406
pilA	Vibrio cholerae C6706	38.667	100	0.406
pilA	Vibrio campbellii strain DS40M4	36.667	100	0.385
pilA/pilAII	Pseudomonas stutzeri DSM 10701	35.862	100	0.364

Detailed information NTG0517931