Detailed information NTG0051456

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: SSUST1_RS00825
• Genome accession: NC_017950
• Coordinates: 132868..133149 (+)
• Length: 93 a.a.
• NCBI ID: WP_014735290.1
• Uniprot ID: -
• Organism: Streptococcus suis ST1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 127868..138149

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SSUST1_RS00805 (SSUST1_0136)	-	129530..129895 (+)	366	WP_014735287.1	DUF1033 family protein	-
SSUST1_RS00810 (SSUST1_0137)	-	129930..130880 (-)	951	WP_014735288.1	S66 peptidase family protein	-
SSUST1_RS00815 (SSUST1_0138)	comGA	130966..131917 (+)	952	Protein_123	competence type IV pilus ATPase ComGA	-
SSUST1_RS00820 (SSUST1_0140)	comYB	131829..132866 (+)	1038	WP_268739958.1	competence type IV pilus assembly protein ComGB	Machinery gene
SSUST1_RS00825 (SSUST1_0141)	comYC	132868..133149 (+)	282	WP_014735290.1	competence type IV pilus major pilin ComGC	Machinery gene
SSUST1_RS00830 (SSUST1_0142)	comGD	133130..133537 (+)	408	WP_014735291.1	competence type IV pilus minor pilin ComGD	-
SSUST1_RS00835 (SSUST1_0143)	comYE	133509..133802 (+)	294	WP_024405248.1	competence type IV pilus minor pilin ComGE	Machinery gene
SSUST1_RS00840 (SSUST1_0144)	comGF/cglF	133789..134223 (+)	435	WP_014735293.1	competence type IV pilus minor pilin ComGF	Machinery gene
SSUST1_RS00845 (SSUST1_0145)	comGG	134201..134722 (+)	522	WP_014735294.1	competence type IV pilus minor pilin ComGG	-
SSUST1_RS00850 (SSUST1_0146)	comYH	134779..135732 (+)	954	WP_014735295.1	class I SAM-dependent methyltransferase	Machinery gene
SSUST1_RS00855 (SSUST1_0147)	-	135782..136969 (+)	1188	WP_012775422.1	acetate kinase	-
SSUST1_RS00860 (SSUST1_0148)	-	137284..137835 (+)	552	WP_012774908.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10435.41 Da
• Isoelectric Point: 8.4285

>NTDB_id=51456 SSUST1_RS00825 WP_014735290.1 132868..133149(+) (comYC) [Streptococcus suis ST1]
MKKLIEMKVKAFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKKGNAAVVKVVESQMELYELEHDEEATVADLQAKGYI
TEKQAKQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=51456 SSUST1_RS00825 WP_014735290.1 132868..133149(+) (comYC) [Streptococcus suis ST1]
ATGAAAAAATTAATTGAAATGAAGGTAAAAGCGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGCATTATTAGTCTGCT
CTTGCTCCTCTTTGTGCCTAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGAATGCTGCCGTTGTCAAAGTAG
TGGAGAGCCAGATGGAGCTCTATGAATTGGAACATGACGAGGAAGCAACGGTGGCAGATTTGCAGGCGAAAGGCTATATT
ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	96.774	100	0.968
comGC/cglC	Streptococcus pneumoniae TIGR4	66.304	98.925	0.656
comGC/cglC	Streptococcus pneumoniae Rx1	66.304	98.925	0.656
comGC/cglC	Streptococcus pneumoniae D39	66.304	98.925	0.656
comGC/cglC	Streptococcus pneumoniae R6	66.304	98.925	0.656
comGC/cglC	Streptococcus mitis SK321	66.304	98.925	0.656
comGC/cglC	Streptococcus mitis NCTC 12261	66.304	98.925	0.656
comYC	Streptococcus gordonii str. Challis substr. CH1	64.045	95.699	0.613
comYC	Streptococcus mutans UA140	61.364	94.624	0.581
comYC	Streptococcus mutans UA159	61.364	94.624	0.581
comGC	Lactococcus lactis subsp. cremoris KW2	57.955	94.624	0.548
comGC	Staphylococcus aureus MW2	51.282	83.871	0.43
comGC	Staphylococcus aureus N315	51.282	83.871	0.43
comGC	Bacillus subtilis subsp. subtilis str. 168	48	80.645	0.387
comGC	Latilactobacillus sakei subsp. sakei 23K	43.75	86.022	0.376