Detailed information NTG0511284

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: STT55_RS08945
• Genome accession: NZ_CP065502
• Coordinates: 1718905..1719231 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain ST55
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1713905..1724231

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
STT55_RS08905	-	1714171..1714509 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
STT55_RS08910 (STT55_08840)	-	1714840..1715037 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
STT55_RS08915 (STT55_08845)	-	1715286..1716479 (-)	1194	WP_022096898.1	acetate kinase	-
STT55_RS08920 (STT55_08850)	comYH	1716535..1717491 (-)	957	WP_173940669.1	class I SAM-dependent methyltransferase	Machinery gene
STT55_RS08925 (STT55_08855)	comGG	1717536..1717853 (-)	318	WP_141326604.1	competence type IV pilus minor pilin ComGG	-
STT55_RS08930 (STT55_08860)	comYF	1717831..1718268 (-)	438	WP_022096897.1	competence type IV pilus minor pilin ComGF	Machinery gene
STT55_RS08935 (STT55_08865)	comGE	1718252..1718545 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
STT55_RS08940 (STT55_08870)	comYD	1718517..1718945 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
STT55_RS08945 (STT55_08875)	comYC	1718905..1719231 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
STT55_RS08950 (STT55_08880)	comYB	1719228..1720328 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
STT55_RS08955 (STT55_08885)	comGA/cglA/cilD	1720210..1721151 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
STT55_RS08960 (STT55_08890)	-	1721232..1721594 (-)	363	WP_173940670.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=511284 STT55_RS08945 WP_002946126.1 1718905..1719231(-) (comYC) [Streptococcus thermophilus strain ST55]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=511284 STT55_RS08945 WP_002946126.1 1718905..1719231(-) (comYC) [Streptococcus thermophilus strain ST55]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361