Detailed information NTG0510924

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ST4145_RS08680
• Genome accession: NZ_CP065492
• Coordinates: 1683046..1683372 (-)
• Length: 108 a.a.
• NCBI ID: WP_014727724.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain 4145
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1678046..1688372

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ST4145_RS08635	-	1678312..1678737 (-)	426	WP_082245829.1	CPBP family intramembrane glutamic endopeptidase	-
ST4145_RS08640	-	1678694..1678969 (-)	276	WP_011681681.1	hypothetical protein	-
ST4145_RS08645 (ST4145_08570)	-	1678981..1679178 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
ST4145_RS08650 (ST4145_08575)	-	1679427..1680620 (-)	1194	WP_014608740.1	acetate kinase	-
ST4145_RS08655 (ST4145_08580)	comYH	1680676..1681632 (-)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
ST4145_RS08660 (ST4145_08585)	comGG	1681677..1681994 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
ST4145_RS08665 (ST4145_08590)	comYF	1681972..1682409 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
ST4145_RS08670 (ST4145_08595)	comGE	1682393..1682686 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
ST4145_RS08675 (ST4145_08600)	comYD	1682658..1683086 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
ST4145_RS08680 (ST4145_08605)	comYC	1683046..1683372 (-)	327	WP_014727724.1	competence type IV pilus major pilin ComGC	Machinery gene
ST4145_RS08685 (ST4145_08610)	comYB	1683369..1684469 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
ST4145_RS08690 (ST4145_08615)	comGA/cglA/cilD	1684351..1685292 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
ST4145_RS08695 (ST4145_08620)	-	1685373..1685735 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11998.11 Da
• Isoelectric Point: 9.6951

>NTDB_id=510924 ST4145_RS08680 WP_014727724.1 1683046..1683372(-) (comYC) [Streptococcus thermophilus strain 4145]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLEALVL
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=510924 ST4145_RS08680 WP_014727724.1 1683046..1683372(-) (comYC) [Streptococcus thermophilus strain 4145]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGAAGCTCTTGTTTTA
GAAGGTCAAATTACTCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	55.66	98.148	0.546
comYC	Streptococcus suis isolate S10	59.091	81.481	0.481
comGC	Staphylococcus aureus MW2	51.282	72.222	0.37
comGC	Staphylococcus aureus N315	51.282	72.222	0.37