Detailed information NTG0510690

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: STAVA1121_RS08915
• Genome accession: NZ_CP065488
• Coordinates: 1692296..1692622 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain AVA1121
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1687296..1697622

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
STAVA1121_RS08875	-	1687564..1687902 (-)	339	WP_347131255.1	CPBP family intramembrane glutamic endopeptidase	-
STAVA1121_RS08880 (STAVA1121_08760)	-	1688232..1688429 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
STAVA1121_RS08885 (STAVA1121_08765)	-	1688677..1689870 (-)	1194	WP_347131256.1	acetate kinase	-
STAVA1121_RS08890 (STAVA1121_08770)	comYH	1689926..1690882 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
STAVA1121_RS08895 (STAVA1121_08775)	comGG	1690927..1691244 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
STAVA1121_RS08900 (STAVA1121_08780)	comYF	1691222..1691659 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
STAVA1121_RS08905 (STAVA1121_08785)	comGE	1691643..1691936 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
STAVA1121_RS08910 (STAVA1121_08790)	comYD	1691908..1692336 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
STAVA1121_RS08915 (STAVA1121_08795)	comYC	1692296..1692622 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
STAVA1121_RS08920 (STAVA1121_08800)	comGB	1692619..1693718 (-)	1100	Protein_1699	competence type IV pilus assembly protein ComGB	-
STAVA1121_RS08925 (STAVA1121_08805)	comGA/cglA/cilD	1693600..1694541 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
STAVA1121_RS08930 (STAVA1121_08810)	-	1694622..1694984 (-)	363	WP_011226630.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=510690 STAVA1121_RS08915 WP_002946126.1 1692296..1692622(-) (comYC) [Streptococcus thermophilus strain AVA1121]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=510690 STAVA1121_RS08915 WP_002946126.1 1692296..1692622(-) (comYC) [Streptococcus thermophilus strain AVA1121]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361