Detailed information NTG0509500

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: I5V48_RS00750
• Genome accession: NZ_CP065430
• Coordinates: 129816..130097 (+)
• Length: 93 a.a.
• NCBI ID: WP_043026803.1
• Uniprot ID: A0A0Z8IB74
• Organism: Streptococcus suis strain YZDH1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 124816..135097

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
I5V48_RS00730 (I5V48_00730)	-	124904..126025 (+)	1122	WP_015445098.1	IS110 family transposase	-
I5V48_RS00735 (I5V48_00735)	-	126879..127829 (-)	951	WP_043026809.1	S66 family peptidase	-
I5V48_RS00740 (I5V48_00740)	comYA	127915..128865 (+)	951	WP_043026808.1	competence type IV pilus ATPase ComGA	Machinery gene
I5V48_RS00745 (I5V48_00745)	comYB	128777..129814 (+)	1038	WP_043026806.1	competence type IV pilus assembly protein ComGB	Machinery gene
I5V48_RS00750 (I5V48_00750)	comYC	129816..130097 (+)	282	WP_043026803.1	competence type IV pilus major pilin ComGC	Machinery gene
I5V48_RS00755 (I5V48_00755)	comGD	130078..130485 (+)	408	WP_043026801.1	competence type IV pilus minor pilin ComGD	-
I5V48_RS00760 (I5V48_00760)	comYE	130457..130750 (+)	294	WP_043026799.1	competence type IV pilus minor pilin ComGE	Machinery gene
I5V48_RS00765 (I5V48_00765)	comGF/cglF	130737..131171 (+)	435	WP_043026797.1	competence type IV pilus minor pilin ComGF	Machinery gene
I5V48_RS00770 (I5V48_00770)	comGG	131149..131676 (+)	528	WP_043026795.1	competence type IV pilus minor pilin ComGG	-
I5V48_RS00775 (I5V48_00775)	comYH	131733..132686 (+)	954	WP_043026794.1	class I SAM-dependent methyltransferase	Machinery gene
I5V48_RS00780 (I5V48_00780)	-	132737..133924 (+)	1188	WP_043026792.1	acetate kinase	-
I5V48_RS00785 (I5V48_00785)	-	134239..134790 (+)	552	WP_043026790.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10460.40 Da
• Isoelectric Point: 8.4204

>NTDB_id=509500 I5V48_RS00750 WP_043026803.1 129816..130097(+) (comYC) [Streptococcus suis strain YZDH1]
MKKLLKLKKKAFTLVEMLVVLGIISLLLLIFVPNLSQQKDAIQEKGNAAVVKVVESQMELYELEHDEEATVADLQAKGYI
TDKQAEQYAKAKK

Nucleotide

• Length: 282 bp

>NTDB_id=509500 I5V48_RS00750 WP_043026803.1 129816..130097(+) (comYC) [Streptococcus suis strain YZDH1]
ATGAAAAAATTGTTGAAATTAAAAAAGAAAGCTTTCACTCTGGTGGAAATGTTAGTTGTTTTGGGTATTATTAGCCTGCT
CTTGCTCATTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCCATTCAGGAGAAAGGGAATGCAGCTGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTATGAATTGGAACATGACGAGGAAGCAACGGTGGCAGATTTGCAGGCGAAAGGCTATATT
ACTGATAAACAAGCGGAGCAGTATGCTAAGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0Z8IB74

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	88.172	100	0.882
comGC/cglC	Streptococcus pneumoniae TIGR4	63.043	98.925	0.624
comGC/cglC	Streptococcus pneumoniae Rx1	63.043	98.925	0.624
comGC/cglC	Streptococcus pneumoniae D39	63.043	98.925	0.624
comGC/cglC	Streptococcus pneumoniae R6	63.043	98.925	0.624
comGC/cglC	Streptococcus mitis NCTC 12261	63.043	98.925	0.624
comGC/cglC	Streptococcus mitis SK321	63.043	98.925	0.624
comYC	Streptococcus gordonii str. Challis substr. CH1	64.045	95.699	0.613
comYC	Streptococcus mutans UA140	59.091	94.624	0.559
comYC	Streptococcus mutans UA159	59.091	94.624	0.559
comGC	Lactococcus lactis subsp. cremoris KW2	55.682	94.624	0.527
comGC	Staphylococcus aureus MW2	47.826	98.925	0.473
comGC	Staphylococcus aureus N315	47.826	98.925	0.473
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	80.645	0.376