Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | H1R75_RS03350 | Genome accession | NZ_CP059471 |
| Coordinates | 608796..609239 (+) | Length | 147 a.a. |
| NCBI ID | WP_182001660.1 | Uniprot ID | - |
| Organism | Streptococcus equinus strain MDC1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 598737..635386 | 608796..609239 | within | 0 |
Gene organization within MGE regions
Location: 598737..635386
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1R75_RS03255 (H1R75_03255) | - | 598755..599603 (+) | 849 | WP_039691038.1 | SGNH/GDSL hydrolase family protein | - |
| H1R75_RS03260 (H1R75_03260) | - | 599572..600174 (+) | 603 | WP_004230808.1 | YpmS family protein | - |
| H1R75_RS03265 (H1R75_03265) | - | 600269..600544 (+) | 276 | WP_009853724.1 | HU family DNA-binding protein | - |
| H1R75_RS03270 (H1R75_03270) | - | 600631..601773 (-) | 1143 | WP_094141150.1 | tyrosine-type recombinase/integrase | - |
| H1R75_RS03275 (H1R75_03275) | - | 601908..602660 (-) | 753 | WP_182001649.1 | hypothetical protein | - |
| H1R75_RS03280 (H1R75_03280) | - | 602714..603094 (-) | 381 | WP_039670719.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H1R75_RS03285 (H1R75_03285) | - | 603119..603496 (-) | 378 | WP_094141140.1 | helix-turn-helix domain-containing protein | - |
| H1R75_RS03290 (H1R75_03290) | - | 603799..604014 (+) | 216 | WP_074629779.1 | transcriptional regulator | - |
| H1R75_RS03295 (H1R75_03295) | - | 604204..604542 (+) | 339 | WP_182001650.1 | hypothetical protein | - |
| H1R75_RS03300 (H1R75_03300) | - | 604627..604938 (+) | 312 | WP_182001651.1 | excisionase | - |
| H1R75_RS03305 (H1R75_03305) | - | 604940..605119 (+) | 180 | WP_182001652.1 | hypothetical protein | - |
| H1R75_RS03310 (H1R75_03310) | - | 605109..605294 (+) | 186 | WP_182001653.1 | hypothetical protein | - |
| H1R75_RS03315 (H1R75_03315) | - | 605295..606185 (+) | 891 | WP_182001654.1 | phage replisome organizer N-terminal domain-containing protein | - |
| H1R75_RS03320 (H1R75_03320) | - | 606186..606410 (+) | 225 | WP_182001655.1 | hypothetical protein | - |
| H1R75_RS03325 (H1R75_03325) | - | 606407..606595 (+) | 189 | WP_182001656.1 | hypothetical protein | - |
| H1R75_RS03330 (H1R75_03330) | - | 606592..606804 (+) | 213 | WP_182001657.1 | hypothetical protein | - |
| H1R75_RS03335 (H1R75_03335) | - | 606826..607644 (+) | 819 | WP_182001658.1 | recombinase RecT | - |
| H1R75_RS03340 (H1R75_03340) | - | 607637..608434 (+) | 798 | WP_182001659.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H1R75_RS09940 (H1R75_03345) | - | 608498..608761 (+) | 264 | WP_413251984.1 | helix-turn-helix domain-containing protein | - |
| H1R75_RS03350 (H1R75_03350) | ssbA | 608796..609239 (+) | 444 | WP_182001660.1 | single-stranded DNA-binding protein | Machinery gene |
| H1R75_RS03355 (H1R75_03355) | - | 609251..609577 (+) | 327 | WP_182001661.1 | hypothetical protein | - |
| H1R75_RS03360 (H1R75_03360) | - | 609574..610050 (+) | 477 | WP_182001662.1 | RusA family crossover junction endodeoxyribonuclease | - |
| H1R75_RS03365 (H1R75_03365) | - | 610035..610283 (+) | 249 | WP_182001663.1 | hypothetical protein | - |
| H1R75_RS03370 (H1R75_03370) | - | 610273..610452 (+) | 180 | WP_182001664.1 | hypothetical protein | - |
| H1R75_RS03375 (H1R75_03375) | - | 610745..611116 (+) | 372 | WP_182001665.1 | hypothetical protein | - |
| H1R75_RS03380 (H1R75_03380) | - | 611109..611681 (+) | 573 | WP_182001666.1 | DUF1642 domain-containing protein | - |
| H1R75_RS03385 (H1R75_03385) | - | 611678..611878 (+) | 201 | WP_182001667.1 | hypothetical protein | - |
| H1R75_RS03390 (H1R75_03390) | - | 611889..612140 (+) | 252 | WP_182001668.1 | hypothetical protein | - |
| H1R75_RS03395 (H1R75_03395) | - | 612140..612553 (+) | 414 | WP_182001669.1 | YopX family protein | - |
| H1R75_RS03400 (H1R75_03400) | - | 612546..612692 (+) | 147 | WP_182001670.1 | hypothetical protein | - |
| H1R75_RS03405 (H1R75_03405) | - | 613135..613560 (+) | 426 | WP_107374543.1 | DUF1492 domain-containing protein | - |
| H1R75_RS03410 (H1R75_03410) | - | 613670..614020 (+) | 351 | WP_182001671.1 | HNH endonuclease | - |
| H1R75_RS03415 (H1R75_03415) | - | 614141..615403 (+) | 1263 | WP_182001672.1 | phage portal protein | - |
| H1R75_RS09780 (H1R75_03420) | - | 615396..616607 (+) | 1212 | WP_182001673.1 | hypothetical protein | - |
| H1R75_RS03425 (H1R75_03425) | - | 616600..616779 (+) | 180 | WP_235686242.1 | CPCC family cysteine-rich protein | - |
| H1R75_RS03430 (H1R75_03430) | - | 616840..616980 (+) | 141 | WP_182001674.1 | hypothetical protein | - |
| H1R75_RS03435 (H1R75_03435) | - | 617032..618444 (+) | 1413 | WP_182001675.1 | DEAD/DEAH box helicase family protein | - |
| H1R75_RS03440 (H1R75_03440) | - | 618520..618975 (+) | 456 | WP_182001676.1 | DUF4355 domain-containing protein | - |
| H1R75_RS03445 (H1R75_03445) | - | 618980..619900 (+) | 921 | WP_094141282.1 | phage major capsid protein | - |
| H1R75_RS09900 | - | 619900..620022 (+) | 123 | WP_268926175.1 | hypothetical protein | - |
| H1R75_RS03450 (H1R75_03450) | - | 620044..620433 (+) | 390 | WP_094141283.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H1R75_RS03455 (H1R75_03455) | - | 620426..620764 (+) | 339 | WP_182001677.1 | hypothetical protein | - |
| H1R75_RS03460 (H1R75_03460) | - | 620757..620996 (+) | 240 | WP_166042944.1 | hypothetical protein | - |
| H1R75_RS03465 (H1R75_03465) | - | 620993..621328 (+) | 336 | WP_182001678.1 | hypothetical protein | - |
| H1R75_RS03470 (H1R75_03470) | - | 621340..621906 (+) | 567 | WP_094141287.1 | phage tail protein | - |
| H1R75_RS03475 (H1R75_03475) | - | 621913..622167 (+) | 255 | WP_182001679.1 | hypothetical protein | - |
| H1R75_RS03480 (H1R75_03480) | - | 622182..622562 (+) | 381 | WP_182001680.1 | DUF5361 domain-containing protein | - |
| H1R75_RS03485 (H1R75_03485) | - | 622552..624927 (+) | 2376 | WP_182001681.1 | phage tail protein | - |
| H1R75_RS03490 (H1R75_03490) | - | 624940..626421 (+) | 1482 | WP_235686255.1 | distal tail protein Dit | - |
| H1R75_RS03495 (H1R75_03495) | - | 626424..628112 (+) | 1689 | WP_182001683.1 | phage tail protein | - |
| H1R75_RS03500 (H1R75_03500) | - | 628127..629254 (+) | 1128 | WP_182001684.1 | hypothetical protein | - |
| H1R75_RS03505 (H1R75_03505) | - | 629266..629511 (+) | 246 | WP_182001685.1 | hypothetical protein | - |
| H1R75_RS03510 (H1R75_03510) | - | 629552..633322 (+) | 3771 | WP_182001686.1 | hypothetical protein | - |
| H1R75_RS03515 (H1R75_03515) | - | 633346..633678 (+) | 333 | WP_182001687.1 | hypothetical protein | - |
| H1R75_RS03520 (H1R75_03520) | - | 633704..633928 (+) | 225 | WP_205397270.1 | hypothetical protein | - |
| H1R75_RS03525 (H1R75_03525) | - | 633925..634122 (+) | 198 | WP_182001688.1 | holin | - |
| H1R75_RS03530 (H1R75_03530) | - | 634106..635386 (+) | 1281 | WP_413251980.1 | LysM peptidoglycan-binding domain-containing protein | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16494.00 Da Isoelectric Point: 4.6677
>NTDB_id=469819 H1R75_RS03350 WP_182001660.1 608796..609239(+) (ssbA) [Streptococcus equinus strain MDC1]
MNNVNLIGRLTKAPELKQTASNTSVLTGTLAVNRTFKNQNGEREADFINIVAWRQTAEIIAQYCGKGSQIGVTGRIQTRN
YENQQGQRVYVTEVVAEHVDLLDTRNESQQGQSNGYNQQPQQNNYNQQESPFGNSNPMDISDDDLPF
MNNVNLIGRLTKAPELKQTASNTSVLTGTLAVNRTFKNQNGEREADFINIVAWRQTAEIIAQYCGKGSQIGVTGRIQTRN
YENQQGQRVYVTEVVAEHVDLLDTRNESQQGQSNGYNQQPQQNNYNQQESPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=469819 H1R75_RS03350 WP_182001660.1 608796..609239(+) (ssbA) [Streptococcus equinus strain MDC1]
ATGAACAACGTAAATTTAATTGGTCGCTTGACGAAAGCGCCAGAACTCAAACAAACAGCGAGCAACACAAGCGTATTAAC
AGGAACGCTTGCAGTGAATCGCACATTCAAGAATCAAAACGGTGAACGTGAAGCAGATTTCATCAACATCGTAGCTTGGC
GACAAACAGCAGAGATTATCGCGCAATATTGCGGCAAAGGTTCGCAAATCGGCGTTACTGGTCGTATCCAGACACGTAAC
TACGAAAATCAGCAAGGACAGCGTGTGTATGTAACTGAAGTCGTAGCTGAACATGTCGACTTGTTAGACACGAGAAACGA
AAGCCAGCAAGGGCAATCAAACGGCTACAATCAGCAACCACAGCAAAACAACTACAATCAGCAGGAAAGCCCATTTGGTA
ATTCAAATCCAATGGACATTTCAGATGATGATCTACCATTCTAA
ATGAACAACGTAAATTTAATTGGTCGCTTGACGAAAGCGCCAGAACTCAAACAAACAGCGAGCAACACAAGCGTATTAAC
AGGAACGCTTGCAGTGAATCGCACATTCAAGAATCAAAACGGTGAACGTGAAGCAGATTTCATCAACATCGTAGCTTGGC
GACAAACAGCAGAGATTATCGCGCAATATTGCGGCAAAGGTTCGCAAATCGGCGTTACTGGTCGTATCCAGACACGTAAC
TACGAAAATCAGCAAGGACAGCGTGTGTATGTAACTGAAGTCGTAGCTGAACATGTCGACTTGTTAGACACGAGAAACGA
AAGCCAGCAAGGGCAATCAAACGGCTACAATCAGCAACCACAGCAAAACAACTACAATCAGCAGGAAAGCCCATTTGGTA
ATTCAAATCCAATGGACATTTCAGATGATGATCTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.047 |
100 |
0.605 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.112 |
100 |
0.565 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.802 |
89.116 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.038 |
89.116 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.038 |
89.116 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.038 |
89.116 |
0.401 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.038 |
89.116 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.038 |
89.116 |
0.401 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
51.754 |
77.551 |
0.401 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.19 |
71.429 |
0.401 |
| ssb | Vibrio cholerae strain A1552 |
32.759 |
100 |
0.388 |
| ssbA | Streptococcus mutans UA159 |
42.748 |
89.116 |
0.381 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
52.381 |
71.429 |
0.374 |
| ssb | Glaesserella parasuis strain SC1401 |
31.073 |
100 |
0.374 |