Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | HMPREF0772_RS08575 | Genome accession | NC_017342 |
| Coordinates | 1695305..1695616 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472257.1 | Uniprot ID | A0A115HMG3 |
| Organism | Staphylococcus aureus subsp. aureus TCH60 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1690305..1700616
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HMPREF0772_RS08545 (HMPREF0772_11593) | - | 1691088..1691291 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| HMPREF0772_RS08550 (HMPREF0772_11594) | - | 1691288..1692274 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| HMPREF0772_RS08555 (HMPREF0772_11595) | - | 1692274..1692603 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| HMPREF0772_RS08560 (HMPREF0772_11596) | - | 1692600..1693223 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| HMPREF0772_RS08565 (HMPREF0772_11597) | comGA | 1693275..1694249 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| HMPREF0772_RS08570 (HMPREF0772_11598) | comGB | 1694221..1695291 (+) | 1071 | WP_000776412.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| HMPREF0772_RS08575 (HMPREF0772_11599) | comGC | 1695305..1695616 (+) | 312 | WP_000472257.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| HMPREF0772_RS08580 (HMPREF0772_11600) | comGD | 1695594..1696040 (+) | 447 | WP_001791207.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| HMPREF0772_RS08585 (HMPREF0772_11601) | comGE | 1696027..1696326 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| HMPREF0772_RS08590 (HMPREF0772_11602) | comGF | 1696244..1696741 (+) | 498 | WP_001799534.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| HMPREF0772_RS08595 | - | 1696838..1696984 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| HMPREF0772_RS08600 (HMPREF0772_11603) | - | 1696974..1697498 (+) | 525 | WP_001015125.1 | shikimate kinase | - |
| HMPREF0772_RS08605 (HMPREF0772_11604) | gcvT | 1697657..1698748 (+) | 1092 | WP_000093347.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| HMPREF0772_RS08610 (HMPREF0772_11605) | gcvPA | 1698768..1700114 (+) | 1347 | WP_000019697.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11373.39 Da Isoelectric Point: 7.8600
>NTDB_id=46476 HMPREF0772_RS08575 WP_000472257.1 1695305..1695616(+) (comGC) [Staphylococcus aureus subsp. aureus TCH60]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=46476 HMPREF0772_RS08575 WP_000472257.1 1695305..1695616(+) (comGC) [Staphylococcus aureus subsp. aureus TCH60]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
99.029 |
100 |
0.99 |
| comGC | Staphylococcus aureus MW2 |
99.029 |
100 |
0.99 |
| comGC/cglC | Streptococcus mitis SK321 |
48.039 |
99.029 |
0.476 |
| comGC/cglC | Streptococcus pneumoniae R6 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae D39 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
52.326 |
83.495 |
0.437 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comYC | Streptococcus mutans UA140 |
50 |
73.786 |
0.369 |
| comYC | Streptococcus mutans UA159 |
50 |
73.786 |
0.369 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |