Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | HF583_RS10385 | Genome accession | NZ_CP051149 |
| Coordinates | 2162062..2162493 (-) | Length | 143 a.a. |
| NCBI ID | WP_110164873.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain 6109 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2131935..2172316 | 2162062..2162493 | within | 0 |
Gene organization within MGE regions
Location: 2131935..2172316
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HF583_RS10155 (HF583_10150) | - | 2131935..2132690 (-) | 756 | WP_065354735.1 | CHAP domain-containing protein | - |
| HF583_RS10160 (HF583_10155) | - | 2132703..2132957 (-) | 255 | WP_065354736.1 | phage holin | - |
| HF583_RS10165 (HF583_10160) | - | 2132975..2134864 (-) | 1890 | WP_065354737.1 | glucosaminidase domain-containing protein | - |
| HF583_RS10170 (HF583_10165) | - | 2134988..2135362 (-) | 375 | WP_065354738.1 | hypothetical protein | - |
| HF583_RS10175 (HF583_10170) | - | 2135395..2136666 (-) | 1272 | WP_065354739.1 | phage baseplate upper protein | - |
| HF583_RS10180 (HF583_10175) | - | 2136683..2137726 (-) | 1044 | WP_015728843.1 | SGNH/GDSL hydrolase family protein | - |
| HF583_RS10185 (HF583_10180) | - | 2137738..2138430 (-) | 693 | WP_015728842.1 | hypothetical protein | - |
| HF583_RS10190 (HF583_10185) | - | 2138434..2139831 (-) | 1398 | WP_015728841.1 | phage tail protein | - |
| HF583_RS10195 (HF583_10190) | - | 2139844..2140776 (-) | 933 | WP_015728840.1 | phage tail family protein | - |
| HF583_RS10200 (HF583_10195) | - | 2140789..2143908 (-) | 3120 | WP_065354740.1 | phage tail protein | - |
| HF583_RS10205 (HF583_10200) | - | 2143925..2144275 (-) | 351 | WP_015728838.1 | hypothetical protein | - |
| HF583_RS10210 (HF583_10205) | - | 2144305..2144685 (-) | 381 | WP_015728837.1 | tail assembly chaperone | - |
| HF583_RS10215 (HF583_10210) | - | 2144745..2145398 (-) | 654 | WP_015728836.1 | phage major tail protein, TP901-1 family | - |
| HF583_RS10220 (HF583_10215) | - | 2145416..2145811 (-) | 396 | WP_015728835.1 | hypothetical protein | - |
| HF583_RS10225 (HF583_10220) | - | 2145823..2146173 (-) | 351 | WP_015728834.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| HF583_RS10230 (HF583_10225) | - | 2146173..2146478 (-) | 306 | WP_041614793.1 | hypothetical protein | - |
| HF583_RS10235 (HF583_10230) | - | 2146475..2146807 (-) | 333 | WP_015728833.1 | phage head-tail connector protein | - |
| HF583_RS10240 (HF583_10235) | - | 2146819..2147268 (-) | 450 | WP_015728832.1 | Ig-like domain-containing protein | - |
| HF583_RS10245 (HF583_10240) | - | 2147358..2148269 (-) | 912 | WP_015728831.1 | hypothetical protein | - |
| HF583_RS10250 (HF583_10245) | - | 2148287..2148895 (-) | 609 | WP_037543590.1 | DUF4355 domain-containing protein | - |
| HF583_RS10255 (HF583_10250) | - | 2149048..2149242 (-) | 195 | WP_037543592.1 | hypothetical protein | - |
| HF583_RS10260 (HF583_10255) | - | 2149242..2150591 (-) | 1350 | WP_037543593.1 | minor capsid protein | - |
| HF583_RS10265 (HF583_10260) | - | 2150584..2152029 (-) | 1446 | WP_037543595.1 | phage portal protein | - |
| HF583_RS10270 (HF583_10265) | - | 2152041..2153315 (-) | 1275 | WP_037543597.1 | PBSX family phage terminase large subunit | - |
| HF583_RS10275 (HF583_10270) | - | 2153302..2153745 (-) | 444 | WP_037543598.1 | terminase small subunit | - |
| HF583_RS10280 (HF583_10275) | - | 2154034..2154459 (-) | 426 | WP_037543601.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| HF583_RS10285 (HF583_10280) | - | 2154460..2154603 (-) | 144 | WP_154800885.1 | hypothetical protein | - |
| HF583_RS10290 (HF583_10285) | - | 2154603..2154770 (-) | 168 | WP_063282639.1 | hypothetical protein | - |
| HF583_RS10295 (HF583_10290) | - | 2154786..2154974 (-) | 189 | WP_037542749.1 | DUF1381 domain-containing protein | - |
| HF583_RS10300 (HF583_10295) | - | 2155038..2155568 (-) | 531 | WP_075773689.1 | dUTP pyrophosphatase | - |
| HF583_RS10305 (HF583_10300) | - | 2155561..2155716 (-) | 156 | WP_162930959.1 | hypothetical protein | - |
| HF583_RS10310 (HF583_10305) | - | 2155718..2155984 (-) | 267 | WP_096636697.1 | hypothetical protein | - |
| HF583_RS10315 (HF583_10310) | - | 2156006..2156167 (-) | 162 | WP_162930960.1 | hypothetical protein | - |
| HF583_RS10320 (HF583_10315) | - | 2156168..2156647 (-) | 480 | WP_065354064.1 | hypothetical protein | - |
| HF583_RS10325 (HF583_10320) | - | 2156648..2156863 (-) | 216 | WP_075773721.1 | hypothetical protein | - |
| HF583_RS10330 (HF583_10325) | - | 2156863..2157258 (-) | 396 | WP_075773720.1 | hypothetical protein | - |
| HF583_RS10335 (HF583_10330) | - | 2157258..2157506 (-) | 249 | WP_065354744.1 | hypothetical protein | - |
| HF583_RS10340 (HF583_10335) | - | 2157506..2157757 (-) | 252 | WP_065354745.1 | hypothetical protein | - |
| HF583_RS13795 | - | 2157754..2157936 (-) | 183 | WP_075773719.1 | hypothetical protein | - |
| HF583_RS10345 (HF583_10340) | - | 2157960..2158412 (-) | 453 | WP_075773718.1 | DUF3310 domain-containing protein | - |
| HF583_RS10350 (HF583_10345) | - | 2158569..2158889 (-) | 321 | WP_199274166.1 | hypothetical protein | - |
| HF583_RS10355 (HF583_10350) | - | 2158902..2159120 (-) | 219 | WP_065354059.1 | hypothetical protein | - |
| HF583_RS10360 (HF583_10355) | - | 2159113..2159544 (-) | 432 | WP_082704422.1 | RusA family crossover junction endodeoxyribonuclease | - |
| HF583_RS10365 (HF583_10360) | - | 2159545..2159724 (-) | 180 | WP_099997373.1 | hypothetical protein | - |
| HF583_RS10370 (HF583_10365) | - | 2159718..2160491 (-) | 774 | WP_100002825.1 | ATP-binding protein | - |
| HF583_RS10375 (HF583_10370) | - | 2160501..2161214 (-) | 714 | WP_100002827.1 | helix-turn-helix domain-containing protein | - |
| HF583_RS10380 (HF583_10375) | - | 2161207..2161878 (-) | 672 | WP_110164874.1 | putative HNHc nuclease | - |
| HF583_RS10385 (HF583_10380) | ssbA | 2162062..2162493 (-) | 432 | WP_110164873.1 | single-stranded DNA-binding protein | Machinery gene |
| HF583_RS10390 (HF583_10385) | - | 2162486..2163130 (-) | 645 | WP_100004523.1 | ERF family protein | - |
| HF583_RS10395 (HF583_10390) | - | 2163134..2163682 (-) | 549 | WP_065354601.1 | host-nuclease inhibitor Gam family protein | - |
| HF583_RS10400 (HF583_10395) | - | 2163675..2163929 (-) | 255 | WP_065354602.1 | hypothetical protein | - |
| HF583_RS10405 (HF583_10400) | - | 2163941..2164216 (-) | 276 | WP_129955935.1 | DUF1108 family protein | - |
| HF583_RS10410 (HF583_10405) | - | 2164286..2164474 (-) | 189 | WP_065354752.1 | hypothetical protein | - |
| HF583_RS10415 (HF583_10410) | - | 2164462..2164686 (-) | 225 | WP_015728800.1 | hypothetical protein | - |
| HF583_RS10420 (HF583_10415) | - | 2164683..2165402 (-) | 720 | WP_100004520.1 | BRO family protein | - |
| HF583_RS10425 (HF583_10420) | - | 2165481..2165708 (+) | 228 | WP_015728798.1 | hypothetical protein | - |
| HF583_RS10430 (HF583_10425) | - | 2165705..2165872 (-) | 168 | WP_015728797.1 | hypothetical protein | - |
| HF583_RS10435 (HF583_10430) | - | 2165978..2166172 (-) | 195 | WP_015728796.1 | hypothetical protein | - |
| HF583_RS10440 (HF583_10435) | - | 2166229..2166492 (+) | 264 | WP_037543667.1 | CRISPR-associated endonuclease Cas2 | - |
| HF583_RS10445 (HF583_10440) | - | 2166496..2166657 (-) | 162 | WP_037543668.1 | hypothetical protein | - |
| HF583_RS10450 (HF583_10445) | - | 2166668..2166904 (-) | 237 | WP_037543670.1 | helix-turn-helix transcriptional regulator | - |
| HF583_RS10455 (HF583_10450) | - | 2167099..2167428 (+) | 330 | WP_037543672.1 | helix-turn-helix transcriptional regulator | - |
| HF583_RS10460 (HF583_10455) | - | 2167436..2167900 (+) | 465 | WP_305961033.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HF583_RS10465 (HF583_10460) | - | 2167957..2168610 (+) | 654 | WP_199274167.1 | hypothetical protein | - |
| HF583_RS10470 (HF583_10465) | - | 2168655..2169092 (+) | 438 | WP_037543680.1 | DUF4231 domain-containing protein | - |
| HF583_RS10475 (HF583_10470) | - | 2169086..2169493 (+) | 408 | WP_037543682.1 | TIR domain-containing protein | - |
| HF583_RS10480 (HF583_10475) | - | 2169490..2169687 (-) | 198 | WP_037543684.1 | hypothetical protein | - |
| HF583_RS10485 (HF583_10480) | - | 2169802..2170851 (+) | 1050 | WP_015728790.1 | site-specific integrase | - |
| HF583_RS10490 (HF583_10485) | sufB | 2170919..2172316 (-) | 1398 | WP_019166866.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 16156.80 Da Isoelectric Point: 5.2164
>NTDB_id=436246 HF583_RS10385 WP_110164873.1 2162062..2162493(-) (ssbA) [Staphylococcus pseudintermedius strain 6109]
MLNRVVLVGRLTKDPEFRTTPSGVSVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLSKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQQQRGQAPAQDNPFTNSNNPIDIDDEDLPF
MLNRVVLVGRLTKDPEFRTTPSGVSVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLSKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQQQRGQAPAQDNPFTNSNNPIDIDDEDLPF
Nucleotide
Download Length: 432 bp
>NTDB_id=436246 HF583_RS10385 WP_110164873.1 2162062..2162493(-) (ssbA) [Staphylococcus pseudintermedius strain 6109]
ATGCTTAATAGAGTTGTATTAGTGGGTCGATTAACAAAAGACCCCGAATTCAGAACGACACCCTCAGGCGTAAGTGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAACGTGAACAACTATCTAAGCAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCAAACAACCAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACTCAAATAATCCGA
TTGACATCGACGATGAAGATTTACCCTTTTGA
ATGCTTAATAGAGTTGTATTAGTGGGTCGATTAACAAAAGACCCCGAATTCAGAACGACACCCTCAGGCGTAAGTGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAACGTGAACAACTATCTAAGCAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCAAACAACCAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACTCAAATAATCCGA
TTGACATCGACGATGAAGATTTACCCTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.395 |
100 |
0.678 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.601 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
74.126 |
0.42 |
| ssbA | Streptococcus mutans UA159 |
41.259 |
100 |
0.413 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.86 |
100 |
0.399 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.161 |
100 |
0.392 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.161 |
100 |
0.392 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
38.462 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
38.462 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
38.462 |
100 |
0.385 |
| ssbB/cilA | Streptococcus mitis SK321 |
38.462 |
100 |
0.385 |
| ssb | Neisseria gonorrhoeae MS11 |
31.214 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
31.214 |
100 |
0.378 |
| ssb | Glaesserella parasuis strain SC1401 |
29.944 |
100 |
0.371 |