NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	HBA50_RS00875	Genome accession	NZ_CP050133
Coordinates	169033..169350 (+)	Length	105 a.a.
NCBI ID	WP_045500288.1	Uniprot ID	-
Organism	Streptococcus cristatus ATCC 51100
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 164033..174350

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HBA50_RS00845 (HBA50_00845)	comW	164801..165028 (+)	228	WP_045500276.1	sigma(X)-activator ComW	-
HBA50_RS00855 (HBA50_00855)	-	165271..166539 (+)	1269	WP_045500279.1	CapA family protein	-
HBA50_RS00860 (HBA50_00860)	-	166674..167045 (+)	372	WP_045500282.1	DUF1033 family protein	-
HBA50_RS00865 (HBA50_00865)	comYA	167131..168072 (+)	942	WP_045500284.1	competence type IV pilus ATPase ComGA	Machinery gene
HBA50_RS00870 (HBA50_00870)	comYB	168020..169036 (+)	1017	WP_045500287.1	competence type IV pilus assembly protein ComGB	Machinery gene
HBA50_RS00875 (HBA50_00875)	comYC	169033..169350 (+)	318	WP_045500288.1	competence type IV pilus major pilin ComGC	Machinery gene
HBA50_RS00880 (HBA50_00880)	comYD	169310..169744 (+)	435	WP_045500291.1	competence type IV pilus minor pilin ComGD	Machinery gene
HBA50_RS00885 (HBA50_00885)	comGE	169710..170003 (+)	294	WP_200893262.1	competence type IV pilus minor pilin ComGE	-
HBA50_RS00890 (HBA50_00890)	comGF/cglF	169987..170424 (+)	438	WP_045500297.1	competence type IV pilus minor pilin ComGF	Machinery gene
HBA50_RS00895 (HBA50_00895)	comGG	170405..170803 (+)	399	WP_045500299.1	competence type IV pilus minor pilin ComGG	-
HBA50_RS00900 (HBA50_00900)	comYH	170884..171849 (+)	966	WP_045500301.1	class I SAM-dependent methyltransferase	Machinery gene
HBA50_RS00905 (HBA50_00905)	-	171885..173078 (+)	1194	WP_045500304.1	acetate kinase	-
HBA50_RS00910 (HBA50_00910)	-	173389..174279 (-)	891	WP_045500311.1	RluA family pseudouridine synthase	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11572.66 Da Isoelectric Point: 10.0731

                                >NTDB_id=430187 HBA50_RS00875 WP_045500288.1 169033..169350(+) (comYC) [Streptococcus cristatus ATCC 51100]

MKKLKTLKVKAFTLVEMLVVLLIISVLMLLFVPNLTRQKDTVSDTGNAAVVKVVESQAELYELKNVNEKATLGKLVADGR

ITDKQVASYKAYYGKNSSEPRAVAD

Nucleotide

Download Length: 318 bp

                                >NTDB_id=430187 HBA50_RS00875 WP_045500288.1 169033..169350(+) (comYC) [Streptococcus cristatus ATCC 51100]

ATGAAAAAATTAAAAACTTTGAAGGTTAAAGCTTTCACTCTGGTGGAAATGTTAGTCGTTCTTTTAATCATCAGCGTCTT

GATGCTCTTGTTTGTTCCGAATTTGACTAGGCAGAAGGATACTGTTTCAGATACGGGCAATGCGGCCGTAGTCAAGGTGG

TAGAAAGTCAGGCTGAGCTTTATGAATTGAAGAATGTTAATGAAAAAGCCACTCTAGGGAAATTGGTTGCTGATGGTCGG

ATTACCGATAAGCAGGTAGCATCCTATAAGGCTTACTATGGAAAAAACAGCAGTGAACCTCGTGCAGTTGCGGATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus gordonii str. Challis substr. CH1	80	100	0.8
comYC	Streptococcus mutans UA140	68.571	100	0.686
comYC	Streptococcus mutans UA159	68.571	100	0.686
comGC/cglC	Streptococcus pneumoniae R6	69.608	97.143	0.676
comGC/cglC	Streptococcus pneumoniae TIGR4	69.608	97.143	0.676
comGC/cglC	Streptococcus mitis SK321	69.608	97.143	0.676
comGC/cglC	Streptococcus pneumoniae Rx1	69.608	97.143	0.676
comGC/cglC	Streptococcus pneumoniae D39	69.608	97.143	0.676
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC	Lactococcus lactis subsp. cremoris KW2	57.692	99.048	0.571
comYC	Streptococcus suis isolate S10	65.169	84.762	0.552

Detailed information NTG0430187