Detailed information NTG0041400

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: HMPREF0833_RS08305
• Genome accession: NC_015678
• Coordinates: 1784114..1784431 (+)
• Length: 105 a.a.
• NCBI ID: WP_003019171.1
• Uniprot ID: F8DGZ2
• Organism: Streptococcus parasanguinis ATCC 15912
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1779114..1789431

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HMPREF0833_RS08285 (HMPREF0833_11653)	-	1780405..1781508 (+)	1104	WP_013904484.1	glycosyl hydrolase family 8	-
HMPREF0833_RS08290 (HMPREF0833_11654)	-	1781734..1782126 (+)	393	WP_037617571.1	DUF1033 family protein	-
HMPREF0833_RS08295 (HMPREF0833_11655)	comYA	1782212..1783153 (+)	942	WP_013904485.1	competence type IV pilus ATPase ComGA	Machinery gene
HMPREF0833_RS08300 (HMPREF0833_11656)	comYB	1783086..1784117 (+)	1032	WP_115276785.1	competence type IV pilus assembly protein ComGB	Machinery gene
HMPREF0833_RS08305 (HMPREF0833_11657)	comYC	1784114..1784431 (+)	318	WP_003019171.1	competence type IV pilus major pilin ComGC	Machinery gene
HMPREF0833_RS08310 (HMPREF0833_11658)	comYD	1784421..1784825 (+)	405	WP_041818518.1	competence type IV pilus minor pilin ComGD	Machinery gene
HMPREF0833_RS08315 (HMPREF0833_11659)	comGE	1784791..1785078 (+)	288	WP_013904488.1	competence type IV pilus minor pilin ComGE	-
HMPREF0833_RS08320 (HMPREF0833_11660)	comGF/cglF	1785068..1785520 (+)	453	WP_003019060.1	competence type IV pilus minor pilin ComGF	Machinery gene
HMPREF0833_RS08325 (HMPREF0833_11661)	comGG	1785477..1785944 (+)	468	WP_255309063.1	competence type IV pilus minor pilin ComGG	-
HMPREF0833_RS08330 (HMPREF0833_11662)	comYH	1785975..1786928 (+)	954	WP_013904490.1	class I SAM-dependent methyltransferase	Machinery gene
HMPREF0833_RS08335 (HMPREF0833_11663)	-	1786980..1788173 (+)	1194	WP_013904491.1	acetate kinase	-
HMPREF0833_RS08340 (HMPREF0833_11664)	-	1788246..1788977 (+)	732	WP_013904492.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11675.59 Da
• Isoelectric Point: 9.6248

>NTDB_id=41400 HMPREF0833_RS08305 WP_003019171.1 1784114..1784431(+) (comYC) [Streptococcus parasanguinis ATCC 15912]
MKKLKTYKVKAFTLIEMLVVLLIISVLLLLFVPNLTKQKDSVKETGNAAVVKVVESQAELYELNHTNDQATLAKLIADGN
ITNKQAESYRSYYAKNSGETRAVAD

Nucleotide

• Length: 318 bp

>NTDB_id=41400 HMPREF0833_RS08305 WP_003019171.1 1784114..1784431(+) (comYC) [Streptococcus parasanguinis ATCC 15912]
ATGAAAAAATTAAAAACCTATAAGGTTAAAGCCTTTACACTTATTGAAATGTTGGTGGTCTTATTGATCATCAGTGTGCT
CTTATTGCTCTTTGTGCCGAATTTGACCAAGCAAAAAGACTCCGTGAAAGAGACAGGAAATGCAGCGGTTGTGAAGGTGG
TCGAAAGTCAGGCTGAATTGTACGAGCTCAATCATACCAATGACCAAGCCACTCTAGCAAAACTGATTGCTGATGGAAAT
ATTACCAACAAACAAGCAGAATCCTACCGTTCCTATTATGCGAAAAATAGTGGAGAAACTCGTGCGGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: F8DGZ2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	75.238	100	0.752
comYC	Streptococcus mutans UA159	73.333	100	0.733
comYC	Streptococcus mutans UA140	73.333	100	0.733
comGC/cglC	Streptococcus mitis SK321	67.89	100	0.705
comGC/cglC	Streptococcus mitis NCTC 12261	66.364	100	0.695
comGC/cglC	Streptococcus pneumoniae Rx1	65.138	100	0.676
comGC/cglC	Streptococcus pneumoniae R6	65.138	100	0.676
comGC/cglC	Streptococcus pneumoniae TIGR4	65.138	100	0.676
comGC/cglC	Streptococcus pneumoniae D39	65.138	100	0.676
comGC	Lactococcus lactis subsp. cremoris KW2	59.615	99.048	0.59
comYC	Streptococcus suis isolate S10	67.416	84.762	0.571
comGC	Staphylococcus aureus N315	45.918	93.333	0.429
comGC	Staphylococcus aureus MW2	45.918	93.333	0.429