Detailed information NTG0411386

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GQY29_RS04100
• Genome accession: NZ_CP047191
• Coordinates: 755595..755921 (+)
• Length: 108 a.a.
• NCBI ID: WP_023909980.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain EU01
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 750595..760921

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GQY29_RS04085 (GQY29_04085)	-	753232..753594 (+)	363	WP_023909982.1	DUF1033 family protein	-
GQY29_RS04090 (GQY29_04090)	comYA	753675..754616 (+)	942	WP_014622005.1	competence type IV pilus ATPase ComGA	Machinery gene
GQY29_RS04095 (GQY29_04095)	comYB	754498..755598 (+)	1101	WP_159340986.1	competence type IV pilus assembly protein ComGB	Machinery gene
GQY29_RS04100 (GQY29_04100)	comYC	755595..755921 (+)	327	WP_023909980.1	competence type IV pilus major pilin ComGC	Machinery gene
GQY29_RS04105 (GQY29_04105)	comYD	755881..756309 (+)	429	WP_171815055.1	competence type IV pilus minor pilin ComGD	Machinery gene
GQY29_RS04110 (GQY29_04110)	comGE	756281..756574 (+)	294	WP_023909978.1	competence type IV pilus minor pilin ComGE	-
GQY29_RS04115 (GQY29_04115)	comYF	756558..756995 (+)	438	WP_084825661.1	competence type IV pilus minor pilin ComGF	Machinery gene
GQY29_RS04120 (GQY29_04120)	comGG	756973..757290 (+)	318	WP_023909975.1	competence type IV pilus minor pilin ComGG	-
GQY29_RS04125 (GQY29_04125)	comYH	757335..758291 (+)	957	WP_023909974.1	class I SAM-dependent methyltransferase	Machinery gene
GQY29_RS04130 (GQY29_04130)	-	758347..759540 (+)	1194	WP_084825660.1	acetate kinase	-
GQY29_RS04135 (GQY29_04135)	-	759788..759985 (+)	198	WP_159340988.1	helix-turn-helix transcriptional regulator	-
GQY29_RS10680 (GQY29_04140)	-	759997..760272 (+)	276	WP_100273190.1	CAAX protease	-
GQY29_RS10685 (GQY29_04145)	-	760316..760654 (+)	339	WP_228024408.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11928.02 Da
• Isoelectric Point: 9.9219

>NTDB_id=411386 GQY29_RS04100 WP_023909980.1 755595..755921(+) (comYC) [Streptococcus thermophilus strain EU01]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFIPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=411386 GQY29_RS04100 WP_023909980.1 755595..755921(+) (comYC) [Streptococcus thermophilus strain EU01]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTATTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	68.269	96.296	0.657
comYC	Streptococcus mutans UA159	68.269	96.296	0.657
comYC	Streptococcus gordonii str. Challis substr. CH1	62.857	97.222	0.611
comGC/cglC	Streptococcus mitis SK321	61.321	98.148	0.602
comGC/cglC	Streptococcus mitis NCTC 12261	57.407	100	0.574
comGC/cglC	Streptococcus pneumoniae D39	57.547	98.148	0.565
comGC/cglC	Streptococcus pneumoniae R6	57.547	98.148	0.565
comGC/cglC	Streptococcus pneumoniae Rx1	57.547	98.148	0.565
comGC/cglC	Streptococcus pneumoniae TIGR4	57.547	98.148	0.565
comGC	Lactococcus lactis subsp. cremoris KW2	55.66	98.148	0.546
comYC	Streptococcus suis isolate S10	59.091	81.481	0.481
comGC	Staphylococcus aureus MW2	51.282	72.222	0.37
comGC	Staphylococcus aureus N315	51.282	72.222	0.37