Detailed information NTG0358765

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: E8M05_RS00835
• Genome accession: NZ_CP039457
• Coordinates: 121100..121393 (+)
• Length: 97 a.a.
• NCBI ID: WP_003062921.1
• Uniprot ID: A0AAW6YIZ6
• Organism: Streptococcus pasteurianus strain WUSP067
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 116100..126393

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E8M05_RS00820 (E8M05_00815)	-	118759..119121 (+)	363	WP_003062916.1	DUF1033 family protein	-
E8M05_RS00825 (E8M05_00820)	comYA	119192..120133 (+)	942	WP_003062917.1	competence type IV pilus ATPase ComGA	Machinery gene
E8M05_RS00830 (E8M05_00825)	comYB	120057..121100 (+)	1044	WP_003062919.1	competence type IV pilus assembly protein ComGB	Machinery gene
E8M05_RS00835 (E8M05_00830)	comYC	121100..121393 (+)	294	WP_003062921.1	competence type IV pilus major pilin ComGC	Machinery gene
E8M05_RS00840 (E8M05_00835)	comYD	121377..121808 (+)	432	WP_003062922.1	competence type IV pilus minor pilin ComGD	Machinery gene
E8M05_RS00845 (E8M05_00840)	comGE	121762..122055 (+)	294	WP_080543606.1	competence type IV pilus minor pilin ComGE	-
E8M05_RS00850 (E8M05_00845)	comYF	122039..122476 (+)	438	WP_041974065.1	competence type IV pilus minor pilin ComGF	Machinery gene
E8M05_RS00855 (E8M05_00850)	comYG	122448..122780 (+)	333	WP_003062925.1	competence type IV pilus minor pilin ComGG	Machinery gene
E8M05_RS00860 (E8M05_00855)	comYH	122835..123806 (+)	972	WP_003062926.1	class I SAM-dependent methyltransferase	Machinery gene
E8M05_RS00865 (E8M05_00860)	-	123844..125043 (+)	1200	WP_003062927.1	acetate kinase	-
E8M05_RS00870 (E8M05_00865)	-	125204..125404 (+)	201	WP_136596396.1	helix-turn-helix transcriptional regulator	-
E8M05_RS00875 (E8M05_00870)	-	125414..125623 (+)	210	WP_003062929.1	hypothetical protein	-
E8M05_RS00880 (E8M05_00875)	-	125660..126088 (+)	429	WP_230321696.1	ABC transporter permease	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 10999.15 Da
• Isoelectric Point: 9.9310

>NTDB_id=358765 E8M05_RS00835 WP_003062921.1 121100..121393(+) (comYC) [Streptococcus pasteurianus strain WUSP067]
MKKIWKKLRKKSVAAFTLVEMLIVLLIISVLMLLFVPNLSKQKDVVREKGDAAVVKVVESQMDLYELKTGDKPTVDDLVE
VGYITSEQAKTYNEAKK

Nucleotide

• Length: 294 bp

>NTDB_id=358765 E8M05_RS00835 WP_003062921.1 121100..121393(+) (comYC) [Streptococcus pasteurianus strain WUSP067]
ATGAAAAAGATTTGGAAAAAATTACGTAAAAAGTCTGTGGCTGCTTTCACACTTGTGGAGATGTTGATTGTGCTTCTTAT
TATCAGTGTTTTAATGTTGCTTTTTGTACCGAATTTGAGTAAGCAAAAGGACGTTGTTCGTGAAAAAGGCGATGCTGCTG
TTGTGAAAGTGGTTGAAAGCCAGATGGATTTGTACGAACTGAAAACGGGAGATAAACCGACTGTTGATGATTTAGTTGAA
GTTGGCTACATCACTTCTGAACAAGCAAAAACTTACAATGAAGCTAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	66.304	94.845	0.629
comGC/cglC	Streptococcus mitis SK321	62.766	96.907	0.608
comYC	Streptococcus gordonii str. Challis substr. CH1	67.045	90.722	0.608
comGC/cglC	Streptococcus pneumoniae D39	61.702	96.907	0.598
comGC/cglC	Streptococcus pneumoniae R6	61.702	96.907	0.598
comGC/cglC	Streptococcus pneumoniae TIGR4	61.702	96.907	0.598
comGC/cglC	Streptococcus pneumoniae Rx1	61.702	96.907	0.598
comGC/cglC	Streptococcus mitis NCTC 12261	61.702	96.907	0.598
comYC	Streptococcus mutans UA140	61.798	91.753	0.567
comYC	Streptococcus mutans UA159	61.798	91.753	0.567
comGC	Lactococcus lactis subsp. cremoris KW2	56.667	92.784	0.526
comGC	Staphylococcus aureus MW2	45.57	81.443	0.371
comGC	Staphylococcus aureus N315	45.57	81.443	0.371