Detailed information NTG0351381

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: E3C75_RS01080
• Genome accession: NZ_CP038020
• Coordinates: 208198..208524 (-)
• Length: 108 a.a.
• NCBI ID: WP_023909980.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain ATCC 19258
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 203198..213524

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E3C75_RS11415	-	203465..203890 (-)	426	WP_111679733.1	CPBP family intramembrane glutamic endopeptidase	-
E3C75_RS01045	-	204133..204330 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
E3C75_RS01050	-	204579..205772 (-)	1194	WP_084826168.1	acetate kinase	-
E3C75_RS01055	comYH	205828..206784 (-)	957	WP_023909974.1	class I SAM-dependent methyltransferase	Machinery gene
E3C75_RS01060	comGG	206829..207146 (-)	318	WP_023909975.1	competence type IV pilus minor pilin ComGG	-
E3C75_RS01065	comYF	207124..207561 (-)	438	WP_084825661.1	competence type IV pilus minor pilin ComGF	Machinery gene
E3C75_RS01070	comGE	207545..207838 (-)	294	WP_100262274.1	competence type IV pilus minor pilin ComGE	-
E3C75_RS01075	comYD	207810..208238 (-)	429	WP_171815055.1	competence type IV pilus minor pilin ComGD	Machinery gene
E3C75_RS01080	comYC	208198..208524 (-)	327	WP_023909980.1	competence type IV pilus major pilin ComGC	Machinery gene
E3C75_RS01085	comYB	208521..209621 (-)	1101	WP_133264040.1	competence type IV pilus assembly protein ComGB	Machinery gene
E3C75_RS01090	comYA	209503..210444 (-)	942	WP_014622005.1	competence type IV pilus ATPase ComGA	Machinery gene
E3C75_RS01095	-	210525..210887 (-)	363	WP_111679734.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11928.02 Da
• Isoelectric Point: 9.9219

>NTDB_id=351381 E3C75_RS01080 WP_023909980.1 208198..208524(-) (comYC) [Streptococcus thermophilus strain ATCC 19258]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFIPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=351381 E3C75_RS01080 WP_023909980.1 208198..208524(-) (comYC) [Streptococcus thermophilus strain ATCC 19258]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTATTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	68.269	96.296	0.657
comYC	Streptococcus mutans UA159	68.269	96.296	0.657
comYC	Streptococcus gordonii str. Challis substr. CH1	62.857	97.222	0.611
comGC/cglC	Streptococcus mitis SK321	61.321	98.148	0.602
comGC/cglC	Streptococcus mitis NCTC 12261	57.407	100	0.574
comGC/cglC	Streptococcus pneumoniae D39	57.547	98.148	0.565
comGC/cglC	Streptococcus pneumoniae R6	57.547	98.148	0.565
comGC/cglC	Streptococcus pneumoniae Rx1	57.547	98.148	0.565
comGC/cglC	Streptococcus pneumoniae TIGR4	57.547	98.148	0.565
comGC	Lactococcus lactis subsp. cremoris KW2	55.66	98.148	0.546
comYC	Streptococcus suis isolate S10	59.091	81.481	0.481
comGC	Staphylococcus aureus MW2	51.282	72.222	0.37
comGC	Staphylococcus aureus N315	51.282	72.222	0.37