Detailed information
Bioinformatically predicted
Overview
| Name | comX/comX2 | Type | Regulator |
| Locus tag | EQH37_RS00065 | Genome accession | NZ_CP035243 |
| Coordinates | 14254..14733 (+) | Length | 159 a.a. |
| NCBI ID | WP_000588874.1 | Uniprot ID | A0AA44S6A3 |
| Organism | Streptococcus pneumoniae strain TVO_1901946 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12174..78171 | 14254..14733 | within | 0 |
Gene organization within MGE regions
Location: 12174..78171
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH37_RS00060 (EQH37_00060) | ftsH | 12174..14132 (+) | 1959 | WP_061765045.1 | ATP-dependent zinc metalloprotease FtsH | - |
| EQH37_RS00065 (EQH37_00065) | comX/comX2 | 14254..14733 (+) | 480 | WP_000588874.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| EQH37_RS00100 (EQH37_00100) | - | 20224..21070 (+) | 847 | Protein_14 | IS630 family transposase | - |
| EQH37_RS00105 (EQH37_00105) | - | 21105..21902 (-) | 798 | Protein_15 | transposase | - |
| EQH37_RS00110 (EQH37_00110) | comW | 22168..22404 (+) | 237 | WP_000939546.1 | sigma(X)-activator ComW | Regulator |
| EQH37_RS00115 (EQH37_00115) | - | 22635..23921 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| EQH37_RS00120 (EQH37_00120) | - | 24163..25311 (-) | 1149 | WP_000876726.1 | site-specific integrase | - |
| EQH37_RS00125 (EQH37_00125) | - | 25485..26297 (-) | 813 | WP_001174227.1 | HIRAN domain-containing protein | - |
| EQH37_RS00130 (EQH37_00130) | - | 26335..26715 (-) | 381 | WP_000170933.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EQH37_RS00135 (EQH37_00135) | - | 26728..26991 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EQH37_RS00140 (EQH37_00140) | - | 26991..27224 (-) | 234 | WP_000156422.1 | hypothetical protein | - |
| EQH37_RS00145 (EQH37_00145) | - | 27224..27592 (-) | 369 | WP_000495824.1 | helix-turn-helix domain-containing protein | - |
| EQH37_RS00150 (EQH37_00150) | - | 27898..28380 (-) | 483 | WP_000842471.1 | hypothetical protein | - |
| EQH37_RS00155 (EQH37_00155) | - | 28435..28638 (+) | 204 | WP_000032099.1 | transcriptional regulator | - |
| EQH37_RS00160 (EQH37_00160) | - | 28655..28852 (+) | 198 | WP_001057654.1 | hypothetical protein | - |
| EQH37_RS00165 | - | 28863..29024 (+) | 162 | WP_001004504.1 | hypothetical protein | - |
| EQH37_RS00170 (EQH37_00165) | - | 29019..29444 (-) | 426 | WP_000386249.1 | hypothetical protein | - |
| EQH37_RS00175 (EQH37_00170) | - | 29498..30208 (+) | 711 | WP_001002359.1 | ORF6C domain-containing protein | - |
| EQH37_RS00180 (EQH37_00175) | - | 30222..30479 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| EQH37_RS00185 (EQH37_00180) | - | 30565..30885 (+) | 321 | WP_000462824.1 | hypothetical protein | - |
| EQH37_RS00190 (EQH37_00185) | - | 30901..31197 (+) | 297 | WP_000391805.1 | hypothetical protein | - |
| EQH37_RS00195 (EQH37_00190) | - | 31190..31996 (+) | 807 | WP_001289771.1 | phage replisome organizer N-terminal domain-containing protein | - |
| EQH37_RS00200 | - | 31984..32142 (+) | 159 | WP_000538418.1 | hypothetical protein | - |
| EQH37_RS00205 (EQH37_00195) | - | 32136..32906 (+) | 771 | WP_000228217.1 | ATP-binding protein | - |
| EQH37_RS10885 (EQH37_00200) | - | 32921..33115 (+) | 195 | WP_000470304.1 | hypothetical protein | - |
| EQH37_RS00210 (EQH37_00205) | - | 33115..33789 (+) | 675 | WP_000975313.1 | DNA methyltransferase | - |
| EQH37_RS00215 (EQH37_00210) | - | 33799..34017 (+) | 219 | WP_000891966.1 | hypothetical protein | - |
| EQH37_RS10810 | - | 34017..34142 (+) | 126 | WP_001854110.1 | hypothetical protein | - |
| EQH37_RS00220 (EQH37_00215) | - | 34102..34269 (+) | 168 | WP_000233203.1 | hypothetical protein | - |
| EQH37_RS00225 (EQH37_00225) | - | 34437..34754 (+) | 318 | WP_000969687.1 | hypothetical protein | - |
| EQH37_RS00230 (EQH37_00230) | - | 34756..35286 (+) | 531 | WP_001021766.1 | DUF1642 domain-containing protein | - |
| EQH37_RS00235 (EQH37_00235) | - | 35286..35573 (+) | 288 | WP_000194860.1 | hypothetical protein | - |
| EQH37_RS00240 (EQH37_00240) | - | 35604..36686 (+) | 1083 | WP_000670043.1 | DNA cytosine methyltransferase | - |
| EQH37_RS00245 (EQH37_00245) | - | 36683..37066 (+) | 384 | WP_001092016.1 | hypothetical protein | - |
| EQH37_RS00250 (EQH37_00250) | - | 37078..37488 (+) | 411 | WP_000612381.1 | YopX family protein | - |
| EQH37_RS00255 (EQH37_00255) | - | 37625..38026 (+) | 402 | WP_000736387.1 | transcriptional activator | - |
| EQH37_RS00260 (EQH37_00260) | - | 38214..38756 (+) | 543 | WP_000397549.1 | site-specific integrase | - |
| EQH37_RS00265 (EQH37_00265) | - | 39133..39453 (+) | 321 | WP_000282422.1 | HNH endonuclease | - |
| EQH37_RS00270 (EQH37_00270) | - | 39590..39982 (+) | 393 | WP_001118284.1 | P27 family phage terminase small subunit | - |
| EQH37_RS00275 (EQH37_00275) | - | 39975..41705 (+) | 1731 | WP_000527303.1 | terminase large subunit | - |
| EQH37_RS00280 (EQH37_00280) | - | 41713..41931 (+) | 219 | WP_001002923.1 | hypothetical protein | - |
| EQH37_RS00285 (EQH37_00285) | - | 41949..43151 (+) | 1203 | WP_000510805.1 | phage portal protein | - |
| EQH37_RS00290 (EQH37_00290) | - | 43135..43710 (+) | 576 | WP_001172115.1 | HK97 family phage prohead protease | - |
| EQH37_RS00295 (EQH37_00295) | - | 43707..44873 (+) | 1167 | WP_001030357.1 | phage major capsid protein | - |
| EQH37_RS00300 (EQH37_00300) | - | 44885..45154 (+) | 270 | WP_000262606.1 | hypothetical protein | - |
| EQH37_RS00305 (EQH37_00305) | - | 45157..45438 (+) | 282 | WP_000370975.1 | hypothetical protein | - |
| EQH37_RS00310 (EQH37_00310) | - | 45425..45724 (+) | 300 | WP_000267060.1 | phage head closure protein | - |
| EQH37_RS00315 (EQH37_00315) | - | 45721..46080 (+) | 360 | WP_000060159.1 | HK97 gp10 family phage protein | - |
| EQH37_RS00320 (EQH37_00320) | - | 46077..46400 (+) | 324 | WP_000777004.1 | hypothetical protein | - |
| EQH37_RS00325 (EQH37_00325) | - | 46412..46990 (+) | 579 | WP_000191276.1 | major tail protein | - |
| EQH37_RS00330 (EQH37_00330) | - | 47002..47421 (+) | 420 | WP_001227148.1 | hypothetical protein | - |
| EQH37_RS00335 (EQH37_00335) | - | 47699..50458 (+) | 2760 | WP_000918323.1 | hypothetical protein | - |
| EQH37_RS00340 (EQH37_00340) | - | 50455..51177 (+) | 723 | WP_000589855.1 | hypothetical protein | - |
| EQH37_RS11015 | - | 51268..52080 (+) | 813 | Protein_65 | phage tail spike protein | - |
| EQH37_RS00345 (EQH37_00345) | - | 52810..61125 (+) | 8316 | WP_409202190.1 | tail fiber domain-containing protein | - |
| EQH37_RS10890 (EQH37_00350) | - | 61122..61238 (+) | 117 | Protein_67 | dihydrodipicolinate reductase | - |
| EQH37_RS00350 (EQH37_00355) | - | 61219..61422 (+) | 204 | WP_001091119.1 | hypothetical protein | - |
| EQH37_RS00355 (EQH37_00360) | - | 61425..61775 (+) | 351 | WP_000852245.1 | hypothetical protein | - |
| EQH37_RS00360 (EQH37_00365) | - | 61784..62200 (+) | 417 | WP_001165339.1 | phage holin family protein | - |
| EQH37_RS00365 (EQH37_00370) | - | 62204..62536 (+) | 333 | WP_001186217.1 | phage holin | - |
| EQH37_RS00370 (EQH37_00375) | - | 62540..63496 (+) | 957 | WP_000350494.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| EQH37_RS00375 (EQH37_00380) | - | 63767..63946 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| EQH37_RS00380 | - | 64088..64237 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| EQH37_RS00385 (EQH37_00385) | tadA | 64519..64986 (+) | 468 | WP_000291874.1 | tRNA adenosine(34) deaminase TadA | - |
| EQH37_RS00395 (EQH37_00395) | - | 65173..65616 (+) | 444 | WP_000701993.1 | dUTP diphosphatase | - |
| EQH37_RS00400 (EQH37_00400) | - | 65618..66133 (+) | 516 | WP_000691237.1 | histidine phosphatase family protein | - |
| EQH37_RS00405 (EQH37_00405) | radA | 66147..67508 (+) | 1362 | WP_075213698.1 | DNA repair protein RadA | Machinery gene |
| EQH37_RS00410 (EQH37_00410) | - | 67581..68078 (+) | 498 | WP_001809420.1 | carbonic anhydrase | - |
| EQH37_RS00415 (EQH37_00415) | - | 68103..68918 (+) | 816 | WP_000749765.1 | PrsW family intramembrane metalloprotease | - |
| EQH37_RS00420 (EQH37_00420) | - | 69063..70031 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| EQH37_RS00425 (EQH37_00425) | - | 70165..70446 (-) | 282 | Protein_82 | transposase family protein | - |
| EQH37_RS00430 | - | 70575..71482 (-) | 908 | Protein_83 | Rpn family recombination-promoting nuclease/putative transposase | - |
| EQH37_RS00435 (EQH37_00445) | polA | 71738..74371 (+) | 2634 | WP_000358434.1 | DNA polymerase I | - |
| EQH37_RS00440 (EQH37_00450) | - | 74456..74893 (+) | 438 | WP_054366136.1 | CoA-binding protein | - |
| EQH37_RS00445 (EQH37_00455) | - | 75076..76086 (-) | 1011 | WP_000009157.1 | YeiH family protein | - |
| EQH37_RS00450 (EQH37_00460) | - | 76235..77404 (+) | 1170 | WP_000366343.1 | pyridoxal phosphate-dependent aminotransferase | - |
| EQH37_RS00455 (EQH37_00465) | recO | 77401..78171 (+) | 771 | WP_000616159.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19845.50 Da Isoelectric Point: 7.3795
>NTDB_id=337180 EQH37_RS00065 WP_000588874.1 14254..14733(+) (comX/comX2) [Streptococcus pneumoniae strain TVO_1901946]
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRK
YDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRK
YDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
Nucleotide
Download Length: 480 bp
>NTDB_id=337180 EQH37_RS00065 WP_000588874.1 14254..14733(+) (comX/comX2) [Streptococcus pneumoniae strain TVO_1901946]
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTGTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
ATCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAAA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGGGGGCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGTGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTGTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
ATCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAAA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGGGGGCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGTGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.