Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DZL14_RS06475 | Genome accession | NZ_CP031640 |
| Coordinates | 1285751..1286170 (-) | Length | 139 a.a. |
| NCBI ID | WP_011054759.1 | Uniprot ID | A0A5S4TJJ6 |
| Organism | Streptococcus pyogenes strain MGAS7888 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1252434..1294467 | 1285751..1286170 | within | 0 |
Gene organization within MGE regions
Location: 1252434..1294467
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZL14_RS06230 (DZL14_06220) | prx | 1252434..1252616 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| DZL14_RS10185 (DZL14_06225) | - | 1252681..1252968 (-) | 288 | WP_011106694.1 | hypothetical protein | - |
| DZL14_RS06240 (DZL14_06230) | - | 1252962..1253537 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| DZL14_RS06245 (DZL14_06235) | spek | 1254013..1254792 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| DZL14_RS06250 (DZL14_06240) | - | 1255096..1255962 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| DZL14_RS06255 (DZL14_06245) | - | 1255950..1256474 (-) | 525 | WP_011017840.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| DZL14_RS06260 (DZL14_06250) | - | 1256614..1257816 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| DZL14_RS06265 (DZL14_06255) | - | 1257927..1258112 (-) | 186 | WP_011054731.1 | holin | - |
| DZL14_RS06270 (DZL14_06260) | - | 1258109..1258405 (-) | 297 | WP_011054732.1 | hypothetical protein | - |
| DZL14_RS06275 (DZL14_06265) | - | 1258416..1259027 (-) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| DZL14_RS06280 (DZL14_06270) | - | 1259030..1259461 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DZL14_RS06285 (DZL14_06275) | - | 1259473..1261362 (-) | 1890 | WP_129849036.1 | gp58-like family protein | - |
| DZL14_RS06290 (DZL14_06280) | - | 1261373..1261687 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZL14_RS06295 (DZL14_06285) | - | 1261689..1262903 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZL14_RS06300 (DZL14_06290) | - | 1262900..1265047 (-) | 2148 | WP_011284971.1 | phage tail spike protein | - |
| DZL14_RS06305 (DZL14_06295) | - | 1265044..1265760 (-) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| DZL14_RS06310 (DZL14_06300) | - | 1265757..1269017 (-) | 3261 | WP_023612368.1 | tape measure protein | - |
| DZL14_RS06315 (DZL14_06305) | - | 1269007..1269588 (-) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| DZL14_RS06320 (DZL14_06310) | - | 1269592..1270026 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| DZL14_RS06325 (DZL14_06315) | - | 1270065..1270550 (-) | 486 | WP_011054741.1 | hypothetical protein | - |
| DZL14_RS06330 (DZL14_06320) | - | 1270550..1270948 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| DZL14_RS06335 (DZL14_06325) | - | 1270945..1271301 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| DZL14_RS06340 (DZL14_06330) | - | 1271301..1271633 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| DZL14_RS06345 (DZL14_06335) | - | 1271623..1272039 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| DZL14_RS06350 (DZL14_06340) | - | 1272093..1272911 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DZL14_RS06355 (DZL14_06345) | - | 1272915..1273529 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| DZL14_RS06360 (DZL14_06350) | - | 1273655..1273921 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| DZL14_RS06365 (DZL14_06355) | - | 1273983..1274222 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| DZL14_RS06370 (DZL14_06360) | - | 1274194..1275672 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| DZL14_RS06375 (DZL14_06365) | - | 1275677..1277179 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| DZL14_RS06380 (DZL14_06370) | - | 1277193..1278404 (-) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| DZL14_RS06385 (DZL14_06375) | - | 1278487..1278960 (-) | 474 | WP_023612332.1 | hypothetical protein | - |
| DZL14_RS06390 (DZL14_06380) | - | 1279011..1279388 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| DZL14_RS06395 (DZL14_06385) | - | 1279449..1279925 (-) | 477 | WP_174143640.1 | GNAT family N-acetyltransferase | - |
| DZL14_RS06400 (DZL14_06390) | - | 1279841..1280518 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| DZL14_RS06405 (DZL14_06395) | - | 1280497..1281015 (-) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| DZL14_RS06410 (DZL14_06400) | - | 1281096..1281353 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| DZL14_RS06430 (DZL14_06420) | - | 1281992..1282432 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZL14_RS10005 | - | 1282706..1282876 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| DZL14_RS06435 (DZL14_06425) | - | 1282873..1283379 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| DZL14_RS10010 | - | 1283376..1283546 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| DZL14_RS06440 (DZL14_06430) | - | 1283543..1283947 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| DZL14_RS06445 (DZL14_06435) | - | 1283957..1284226 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| DZL14_RS06450 (DZL14_06440) | - | 1284223..1284507 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| DZL14_RS06455 (DZL14_06445) | - | 1284501..1284752 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| DZL14_RS06460 (DZL14_06450) | - | 1284749..1285105 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| DZL14_RS06465 (DZL14_06455) | - | 1285102..1285542 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DZL14_RS06470 (DZL14_06460) | - | 1285542..1285745 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| DZL14_RS06475 (DZL14_06465) | ssbA | 1285751..1286170 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| DZL14_RS06480 (DZL14_06470) | - | 1286163..1286837 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| DZL14_RS06485 (DZL14_06475) | - | 1286838..1287320 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| DZL14_RS06490 (DZL14_06480) | - | 1287342..1287596 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| DZL14_RS06495 (DZL14_06485) | - | 1287607..1287747 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| DZL14_RS06500 (DZL14_06490) | - | 1287744..1287977 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| DZL14_RS06505 (DZL14_06495) | - | 1287958..1288371 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| DZL14_RS06510 (DZL14_06500) | - | 1288493..1288750 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| DZL14_RS06515 (DZL14_06505) | - | 1288844..1289029 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| DZL14_RS06520 (DZL14_06510) | - | 1289058..1289315 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| DZL14_RS06530 (DZL14_06520) | - | 1289561..1289728 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| DZL14_RS06535 (DZL14_06525) | - | 1289804..1290004 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| DZL14_RS10015 | - | 1290001..1290150 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| DZL14_RS06540 (DZL14_06530) | - | 1290183..1290911 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| DZL14_RS06545 (DZL14_06535) | - | 1290922..1291113 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| DZL14_RS06550 (DZL14_06540) | - | 1291909..1292268 (+) | 360 | WP_011054768.1 | helix-turn-helix transcriptional regulator | - |
| DZL14_RS06555 (DZL14_06545) | - | 1292282..1292662 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DZL14_RS06560 (DZL14_06550) | - | 1292673..1293194 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| DZL14_RS06565 (DZL14_06555) | - | 1293370..1294467 (+) | 1098 | WP_015967409.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15649.29 Da Isoelectric Point: 4.8660
>NTDB_id=309226 DZL14_RS06475 WP_011054759.1 1285751..1286170(-) (ssbA) [Streptococcus pyogenes strain MGAS7888]
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=309226 DZL14_RS06475 WP_011054759.1 1285751..1286170(-) (ssbA) [Streptococcus pyogenes strain MGAS7888]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.857 |
100 |
0.691 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.882 |
100 |
0.683 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.043 |
100 |
0.46 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.324 |
100 |
0.453 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.604 |
100 |
0.446 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.955 |
79.856 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
41.727 |
100 |
0.417 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.388 |
| ssb | Glaesserella parasuis strain SC1401 |
28.814 |
100 |
0.367 |