Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   DZL14_RS06230 Genome accession   NZ_CP031640
Coordinates   1252434..1252616 (-) Length   60 a.a.
NCBI ID   WP_011054726.1    Uniprot ID   A0A5S4TS04
Organism   Streptococcus pyogenes strain MGAS7888     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1252434..1294467 1252434..1252616 within 0


Gene organization within MGE regions


Location: 1252434..1294467
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DZL14_RS06230 (DZL14_06220) prx 1252434..1252616 (-) 183 WP_011054726.1 hypothetical protein Regulator
  DZL14_RS10185 (DZL14_06225) - 1252681..1252968 (-) 288 WP_011106694.1 hypothetical protein -
  DZL14_RS06240 (DZL14_06230) - 1252962..1253537 (-) 576 WP_011054727.1 hypothetical protein -
  DZL14_RS06245 (DZL14_06235) spek 1254013..1254792 (-) 780 WP_011054728.1 streptococcal pyrogenic exotoxin SpeK -
  DZL14_RS06250 (DZL14_06240) - 1255096..1255962 (-) 867 WP_011054729.1 DUF334 domain-containing protein -
  DZL14_RS06255 (DZL14_06245) - 1255950..1256474 (-) 525 WP_011017840.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  DZL14_RS06260 (DZL14_06250) - 1256614..1257816 (-) 1203 WP_011054730.1 glucosaminidase domain-containing protein -
  DZL14_RS06265 (DZL14_06255) - 1257927..1258112 (-) 186 WP_011054731.1 holin -
  DZL14_RS06270 (DZL14_06260) - 1258109..1258405 (-) 297 WP_011054732.1 hypothetical protein -
  DZL14_RS06275 (DZL14_06265) - 1258416..1259027 (-) 612 WP_011054733.1 DUF1366 domain-containing protein -
  DZL14_RS06280 (DZL14_06270) - 1259030..1259461 (-) 432 WP_002987513.1 DUF1617 family protein -
  DZL14_RS06285 (DZL14_06275) - 1259473..1261362 (-) 1890 WP_129849036.1 gp58-like family protein -
  DZL14_RS06290 (DZL14_06280) - 1261373..1261687 (-) 315 WP_021340983.1 hypothetical protein -
  DZL14_RS06295 (DZL14_06285) - 1261689..1262903 (-) 1215 WP_011284843.1 hypothetical protein -
  DZL14_RS06300 (DZL14_06290) - 1262900..1265047 (-) 2148 WP_011284971.1 phage tail spike protein -
  DZL14_RS06305 (DZL14_06295) - 1265044..1265760 (-) 717 WP_011054737.1 distal tail protein Dit -
  DZL14_RS06310 (DZL14_06300) - 1265757..1269017 (-) 3261 WP_023612368.1 tape measure protein -
  DZL14_RS06315 (DZL14_06305) - 1269007..1269588 (-) 582 WP_011284973.1 bacteriophage Gp15 family protein -
  DZL14_RS06320 (DZL14_06310) - 1269592..1270026 (-) 435 WP_011054740.1 hypothetical protein -
  DZL14_RS06325 (DZL14_06315) - 1270065..1270550 (-) 486 WP_011054741.1 hypothetical protein -
  DZL14_RS06330 (DZL14_06320) - 1270550..1270948 (-) 399 WP_010922084.1 minor capsid protein -
  DZL14_RS06335 (DZL14_06325) - 1270945..1271301 (-) 357 WP_010922083.1 minor capsid protein -
  DZL14_RS06340 (DZL14_06330) - 1271301..1271633 (-) 333 WP_010922082.1 minor capsid protein -
  DZL14_RS06345 (DZL14_06335) - 1271623..1272039 (-) 417 WP_011054743.1 hypothetical protein -
  DZL14_RS06350 (DZL14_06340) - 1272093..1272911 (-) 819 WP_010922080.1 N4-gp56 family major capsid protein -
  DZL14_RS06355 (DZL14_06345) - 1272915..1273529 (-) 615 WP_011106689.1 hypothetical protein -
  DZL14_RS06360 (DZL14_06350) - 1273655..1273921 (-) 267 WP_011054745.1 hypothetical protein -
  DZL14_RS06365 (DZL14_06355) - 1273983..1274222 (-) 240 WP_002986829.1 hypothetical protein -
  DZL14_RS06370 (DZL14_06360) - 1274194..1275672 (-) 1479 WP_011054746.1 phage minor capsid protein -
  DZL14_RS06375 (DZL14_06365) - 1275677..1277179 (-) 1503 WP_002986832.1 phage portal protein -
  DZL14_RS06380 (DZL14_06370) - 1277193..1278404 (-) 1212 WP_010922074.1 PBSX family phage terminase large subunit -
  DZL14_RS06385 (DZL14_06375) - 1278487..1278960 (-) 474 WP_023612332.1 hypothetical protein -
  DZL14_RS06390 (DZL14_06380) - 1279011..1279388 (-) 378 WP_002986841.1 ASCH domain-containing protein -
  DZL14_RS06395 (DZL14_06385) - 1279449..1279925 (-) 477 WP_174143640.1 GNAT family N-acetyltransferase -
  DZL14_RS06400 (DZL14_06390) - 1279841..1280518 (-) 678 WP_002986850.1 ABC transporter ATP-binding protein -
  DZL14_RS06405 (DZL14_06395) - 1280497..1281015 (-) 519 WP_002986854.1 ParB N-terminal domain-containing protein -
  DZL14_RS06410 (DZL14_06400) - 1281096..1281353 (+) 258 WP_011054748.1 hypothetical protein -
  DZL14_RS06430 (DZL14_06420) - 1281992..1282432 (-) 441 WP_011017866.1 ArpU family phage packaging/lysis transcriptional regulator -
  DZL14_RS10005 - 1282706..1282876 (-) 171 WP_164997036.1 hypothetical protein -
  DZL14_RS06435 (DZL14_06425) - 1282873..1283379 (-) 507 WP_011054751.1 DUF1642 domain-containing protein -
  DZL14_RS10010 - 1283376..1283546 (-) 171 WP_011054752.1 hypothetical protein -
  DZL14_RS06440 (DZL14_06430) - 1283543..1283947 (-) 405 WP_011054753.1 YopX family protein -
  DZL14_RS06445 (DZL14_06435) - 1283957..1284226 (-) 270 WP_011054754.1 hypothetical protein -
  DZL14_RS06450 (DZL14_06440) - 1284223..1284507 (-) 285 WP_011054755.1 DUF3310 domain-containing protein -
  DZL14_RS06455 (DZL14_06445) - 1284501..1284752 (-) 252 WP_011054756.1 hypothetical protein -
  DZL14_RS06460 (DZL14_06450) - 1284749..1285105 (-) 357 WP_011054757.1 hypothetical protein -
  DZL14_RS06465 (DZL14_06455) - 1285102..1285542 (-) 441 WP_011054758.1 RusA family crossover junction endodeoxyribonuclease -
  DZL14_RS06470 (DZL14_06460) - 1285542..1285745 (-) 204 WP_011106686.1 hypothetical protein -
  DZL14_RS06475 (DZL14_06465) ssbA 1285751..1286170 (-) 420 WP_011054759.1 single-stranded DNA-binding protein Machinery gene
  DZL14_RS06480 (DZL14_06470) - 1286163..1286837 (-) 675 WP_011054760.1 ERF family protein -
  DZL14_RS06485 (DZL14_06475) - 1286838..1287320 (-) 483 WP_011018142.1 siphovirus Gp157 family protein -
  DZL14_RS06490 (DZL14_06480) - 1287342..1287596 (-) 255 WP_011054761.1 hypothetical protein -
  DZL14_RS06495 (DZL14_06485) - 1287607..1287747 (-) 141 WP_011284979.1 hypothetical protein -
  DZL14_RS06500 (DZL14_06490) - 1287744..1287977 (-) 234 WP_011054762.1 hypothetical protein -
  DZL14_RS06505 (DZL14_06495) - 1287958..1288371 (-) 414 WP_011054763.1 DnaD domain protein -
  DZL14_RS06510 (DZL14_06500) - 1288493..1288750 (-) 258 WP_011106684.1 hypothetical protein -
  DZL14_RS06515 (DZL14_06505) - 1288844..1289029 (-) 186 WP_011054765.1 hypothetical protein -
  DZL14_RS06520 (DZL14_06510) - 1289058..1289315 (-) 258 WP_002988339.1 hypothetical protein -
  DZL14_RS06530 (DZL14_06520) - 1289561..1289728 (-) 168 WP_002986885.1 hypothetical protein -
  DZL14_RS06535 (DZL14_06525) - 1289804..1290004 (+) 201 WP_002986887.1 KTSC domain-containing protein -
  DZL14_RS10015 - 1290001..1290150 (-) 150 WP_002986888.1 hypothetical protein -
  DZL14_RS06540 (DZL14_06530) - 1290183..1290911 (-) 729 WP_011054767.1 phage antirepressor KilAC domain-containing protein -
  DZL14_RS06545 (DZL14_06535) - 1290922..1291113 (-) 192 WP_002986891.1 hypothetical protein -
  DZL14_RS06550 (DZL14_06540) - 1291909..1292268 (+) 360 WP_011054768.1 helix-turn-helix transcriptional regulator -
  DZL14_RS06555 (DZL14_06545) - 1292282..1292662 (+) 381 WP_002986894.1 ImmA/IrrE family metallo-endopeptidase -
  DZL14_RS06560 (DZL14_06550) - 1292673..1293194 (+) 522 WP_002986895.1 hypothetical protein -
  DZL14_RS06565 (DZL14_06555) - 1293370..1294467 (+) 1098 WP_015967409.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 6771.70 Da        Isoelectric Point: 3.9944

>NTDB_id=309225 DZL14_RS06230 WP_011054726.1 1252434..1252616(-) (prx) [Streptococcus pyogenes strain MGAS7888]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK

Nucleotide


Download         Length: 183 bp        

>NTDB_id=309225 DZL14_RS06230 WP_011054726.1 1252434..1252616(-) (prx) [Streptococcus pyogenes strain MGAS7888]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5S4TS04

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

100

100

1

  prx Streptococcus pyogenes MGAS8232

80

100

0.8

  prx Streptococcus pyogenes MGAS315

80

100

0.8

  prx Streptococcus pyogenes MGAS315

80

100

0.8

  prx Streptococcus pyogenes MGAS315

78.333

100

0.783

  prx Streptococcus pyogenes MGAS315

73.333

100

0.733

  prx Streptococcus pyogenes MGAS315

87.805

68.333

0.6


Multiple sequence alignment