Detailed information
Experimentally validated
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYM3_RS05770 | Genome accession | NC_004070 |
| Coordinates | 1137743..1137925 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes MGAS315 | ||
| Function | Inhibit ComR activation Competence regulation |
||
Function
In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1137743..1173755 | 1137743..1137925 | within | 0 |
Gene organization within MGE regions
Location: 1137743..1173755
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM3_RS05770 (SpyM3_1094) | prx | 1137743..1137925 (-) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
| SPYM3_RS05775 (SpyM3_1095) | - | 1137992..1138786 (-) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| SPYM3_RS05780 (SpyM3_1096) | - | 1139031..1140245 (-) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| SPYM3_RS05790 (SpyM3_1097) | - | 1140357..1140812 (-) | 456 | WP_002983475.1 | phage holin family protein | - |
| SPYM3_RS05795 (SpyM3_1098) | - | 1140823..1141437 (-) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| SPYM3_RS05800 (SpyM3_1099) | - | 1141440..1141871 (-) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| SPYM3_RS05805 (SpyM3_1100) | - | 1141880..1143661 (-) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| SPYM3_RS05810 (SpyM3_1101) | - | 1143676..1144785 (-) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| SPYM3_RS05815 (SpyM3_1102) | - | 1144785..1146758 (-) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| SPYM3_RS05820 (SpyM3_1103) | - | 1146740..1147435 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| SPYM3_RS05825 (SpyM3_1104) | - | 1147432..1149795 (-) | 2364 | WP_011054677.1 | phage tail protein | - |
| SPYM3_RS05830 (SpyM3_1105) | - | 1149795..1150166 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| SPYM3_RS05835 (SpyM3_1106) | - | 1150181..1150444 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| SPYM3_RS05840 (SpyM3_1107) | - | 1150455..1151045 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| SPYM3_RS05845 (SpyM3_1108) | - | 1151061..1151396 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| SPYM3_RS05850 (SpyM3_1109) | - | 1151397..1151633 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| SPYM3_RS05855 (SpyM3_1110) | - | 1151626..1151964 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| SPYM3_RS05860 (SpyM3_1111) | - | 1151924..1152346 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SPYM3_RS05865 (SpyM3_1112) | - | 1152356..1152556 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| SPYM3_RS05870 (SpyM3_1113) | - | 1152556..1153467 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| SPYM3_RS05875 (SpyM3_1114) | - | 1153492..1153953 (-) | 462 | WP_011054684.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| SPYM3_RS05880 (SpyM3_1115) | - | 1154034..1155449 (-) | 1416 | WP_011054685.1 | terminase | - |
| SPYM3_RS05885 (SpyM3_1116) | - | 1155531..1155746 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| SPYM3_RS05890 (SpyM3_1117) | - | 1155748..1156014 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| SPYM3_RS10355 (SpyM3_1118) | - | 1156007..1156159 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| SPYM3_RS05895 (SpyM3_1119) | - | 1156236..1156460 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| SPYM3_RS05900 (SpyM3_1120) | - | 1156466..1157959 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| SPYM3_RS05905 (SpyM3_1121) | - | 1157952..1159220 (-) | 1269 | WP_011054689.1 | phage portal protein | - |
| SPYM3_RS05910 (SpyM3_1122) | - | 1159217..1159573 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| SPYM3_RS05915 (SpyM3_1123) | - | 1159721..1160065 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| SPYM3_RS05920 (SpyM3_1124) | - | 1160173..1160592 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| SPYM3_RS05925 (SpyM3_1125) | - | 1160668..1160919 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| SPYM3_RS10360 (SpyM3_1126) | - | 1160916..1161071 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| SPYM3_RS05930 (SpyM3_1127) | - | 1161068..1161385 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| SPYM3_RS05935 (SpyM3_1128) | - | 1161421..1161933 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| SPYM3_RS05940 (SpyM3_1129) | - | 1161930..1162262 (-) | 333 | WP_011054696.1 | hypothetical protein | - |
| SPYM3_RS05945 (SpyM3_1130) | - | 1162273..1163619 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| SPYM3_RS05950 (SpyM3_1131) | - | 1163616..1164011 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| SPYM3_RS05955 (SpyM3_1132) | - | 1164376..1165173 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SPYM3_RS05960 (SpyM3_1133) | - | 1165166..1165366 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| SPYM3_RS05965 (SpyM3_1134) | - | 1165363..1166289 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| SPYM3_RS05970 | - | 1166292..1166622 (-) | 331 | Protein_1148 | hypothetical protein | - |
| SPYM3_RS05975 (SpyM3_1137) | - | 1166678..1166884 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| SPYM3_RS10245 | - | 1166893..1167033 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| SPYM3_RS05980 (SpyM3_1138) | - | 1167030..1167263 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| SPYM3_RS05985 (SpyM3_1139) | - | 1167244..1167630 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| SPYM3_RS10525 | - | 1167771..1168040 (-) | 270 | WP_011106700.1 | replication protein | - |
| SPYM3_RS05995 (SpyM3_1140) | - | 1168134..1168319 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| SPYM3_RS06000 (SpyM3_1141) | - | 1168321..1168632 (-) | 312 | WP_010922478.1 | excisionase | - |
| SPYM3_RS06005 (SpyM3_1142) | - | 1168902..1169114 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| SPYM3_RS06010 (SpyM3_1143) | - | 1169316..1170071 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| SPYM3_RS06015 (SpyM3_1144) | - | 1170083..1170601 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| SPYM3_RS06020 (SpyM3_1145) | - | 1170725..1171867 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| SPYM3_RS06025 (SpyM3_1146) | - | 1171956..1172231 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SPYM3_RS06030 (SpyM3_1147) | - | 1172330..1172917 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| SPYM3_RS06035 (SpyM3_1148) | - | 1172895..1173737 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| prx | comR | negative effect  |
| comR | comX/sigX/comX2/sigX2 | positive effect  |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comR | comX/sigX/comX1/sigX1 | positive effect |
| comS | comX/sigX/comX1/sigX1 | positive effect |
| clpP | comX/sigX/comX1/sigX1 | negative effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comS | comX/sigX/comX2/sigX2 | positive effect |
| clpP | comX/sigX/comX2/sigX2 | negative effect |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=548 SPYM3_RS05770 WP_011054671.1 1137743..1137925(-) (prx) [Streptococcus pyogenes MGAS315]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=548 SPYM3_RS05770 WP_011054671.1 1137743..1137925(-) (prx) [Streptococcus pyogenes MGAS315]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
Multiple sequence alignment
References
| [1] | Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983] |