Detailed information NTG0000548

Experimentally validated

Overview

• Name: prx
• Type: Regulator
• Locus tag: SPYM3_RS05770
• Genome accession: NC_004070
• Coordinates: 1137743..1137925 (-)
• Length: 60 a.a.
• NCBI ID: WP_011054671.1
• Uniprot ID: Q4VUT1
• Organism: Streptococcus pyogenes MGAS315
• Function: Inhibit ComR activation Competence regulation

Function

In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.

Genomic Context

Location: 1132743..1142925

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPYM3_RS05755 (SpyM3_1090)	-	1133182..1133877 (-)	696	WP_002983928.1	phosphoglycerate mutase	-
SPYM3_RS05760 (SpyM3_1091)	-	1134116..1135051 (+)	936	WP_011054669.1	dihydroorotate oxidase	-
SPYM3_RS05765 (SpyM3_1093)	-	1135351..1137213 (-)	1863	WP_011054670.1	heavy metal translocating P-type ATPase	-
SPYM3_RS05770 (SpyM3_1094)	prx	1137743..1137925 (-)	183	WP_011054671.1	hypothetical protein	Regulator
SPYM3_RS05775 (SpyM3_1095)	-	1137992..1138786 (-)	795	WP_002983479.1	DNA/RNA non-specific endonuclease	-
SPYM3_RS05780 (SpyM3_1096)	-	1139031..1140245 (-)	1215	WP_002983477.1	peptidoglycan amidohydrolase family protein	-
SPYM3_RS05790 (SpyM3_1097)	-	1140357..1140812 (-)	456	WP_002983475.1	phage holin family protein	-
SPYM3_RS05795 (SpyM3_1098)	-	1140823..1141437 (-)	615	WP_011054672.1	DUF1366 domain-containing protein	-
SPYM3_RS05800 (SpyM3_1099)	-	1141440..1141871 (-)	432	WP_011054673.1	DUF1617 family protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
prx	comR	negative effect
comR	comX/sigX/comX2/sigX2	positive effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comR	comX/sigX/comX1/sigX1	positive effect
comS	comX/sigX/comX1/sigX1	positive effect
clpP	comX/sigX/comX1/sigX1	negative effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comS	comX/sigX/comX2/sigX2	positive effect
clpP	comX/sigX/comX2/sigX2	negative effect

Sequence

Protein

• Length: 60 a.a.
• Molecular weight: 6978.99 Da
• Isoelectric Point: 4.3466

>NTDB_id=548 SPYM3_RS05770 WP_011054671.1 1137743..1137925(-) (prx) [Streptococcus pyogenes MGAS315]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR

Nucleotide

• Length: 183 bp

>NTDB_id=548 SPYM3_RS05770 WP_011054671.1 1137743..1137925(-) (prx) [Streptococcus pyogenes MGAS315]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA

Domains

No domain identified.

3D structure

• AlphaFold DB: Q4VUT1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
prx	Streptococcus pyogenes MGAS8232	85	100	0.85
prx	Streptococcus pyogenes MGAS315	78.333	100	0.783
prx	Streptococcus pyogenes MGAS315	82.759	93.548	0.774
prx	Streptococcus pyogenes MGAS315	73.333	100	0.733
prx	Streptococcus pyogenes MGAS315	73.333	100	0.733
prx	Streptococcus pyogenes MGAS315	68.333	100	0.683

References

• [1]: Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983]