Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYM3_RS04945 | Genome accession | NC_004070 |
| Coordinates | 977437..977625 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A0H2UUN1 |
| Organism | Streptococcus pyogenes MGAS315 | ||
| Function | Inhibit ComR activation Competence regulation |
||
Function
In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.
Genomic Context
Location: 972437..982625
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM3_RS04925 (SpyM3_0915) | - | 974237..974608 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| SPYM3_RS04930 (SpyM3_0916) | - | 974608..975306 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| SPYM3_RS04935 (SpyM3_0917) | - | 975316..976101 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| SPYM3_RS04940 (SpyM3_0918) | - | 976232..976846 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| SPYM3_RS04945 (SpyM3_0919) | prx | 977437..977625 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| SPYM3_RS04950 (SpyM3_0920) | entC3 | 977738..978520 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| SPYM3_RS04955 (SpyM3_0921) | - | 978733..979857 (-) | 1125 | WP_011054547.1 | Fic family protein | - |
| SPYM3_RS04960 (SpyM3_0922) | - | 979995..981203 (-) | 1209 | WP_011054548.1 | glucosaminidase domain-containing protein | - |
| SPYM3_RS04970 (SpyM3_0923) | - | 981319..981546 (-) | 228 | WP_000609113.1 | phage holin | - |
| SPYM3_RS04975 (SpyM3_0924) | - | 981543..981818 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| SPYM3_RS04980 (SpyM3_0925) | - | 981828..982445 (-) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| prx | comR | negative effect |
| comR | comX/sigX/comX2/sigX2 | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comR | comX/sigX/comX1/sigX1 | positive effect |
| comS | comX/sigX/comX1/sigX1 | positive effect |
| clpP | comX/sigX/comX1/sigX1 | negative effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comS | comX/sigX/comX2/sigX2 | positive effect |
| clpP | comX/sigX/comX2/sigX2 | negative effect |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |
Multiple sequence alignment
References
| [1] | Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983] |