Detailed information NTG0000550

Experimentally validated

Overview

• Name: prx
• Type: Regulator
• Locus tag: SPYM3_RS06310
• Genome accession: NC_004070
• Coordinates: 1230304..1230486 (-)
• Length: 60 a.a.
• NCBI ID: WP_011054726.1
• Uniprot ID: A0A0H2UVL5
• Organism: Streptococcus pyogenes MGAS315
• Function: Inhibit ComR activation Competence regulation

Function

In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.

Genomic Context

Location: 1225304..1235486

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPYM3_RS06290 (SpyM3_1199)	-	1225707..1226423 (-)	717	WP_011054722.1	B3/B4 domain-containing protein	-
SPYM3_RS06295 (SpyM3_1200)	-	1226437..1227516 (-)	1080	WP_011054723.1	MmcQ/YjbR family DNA-binding protein	-
SPYM3_RS06300 (SpyM3_1201)	-	1227589..1229322 (-)	1734	WP_011054724.1	cache domain-containing sensor histidine kinase	-
SPYM3_RS06305 (SpyM3_1202)	-	1229319..1230059 (-)	741	WP_011054725.1	response regulator transcription factor	-
SPYM3_RS06310 (SpyM3_1203)	prx	1230304..1230486 (-)	183	WP_011054726.1	hypothetical protein	Regulator
SPYM3_RS06320 (SpyM3_1204)	-	1230832..1231407 (-)	576	WP_011054727.1	hypothetical protein	-
SPYM3_RS06325 (SpyM3_1205)	spek	1231883..1232662 (-)	780	WP_011054728.1	streptococcal pyrogenic exotoxin SpeK	-
SPYM3_RS06330 (SpyM3_1206)	-	1232966..1233832 (-)	867	WP_011054729.1	DUF334 domain-containing protein	-
SPYM3_RS06335 (SpyM3_1207)	-	1233820..1234344 (-)	525	WP_011017840.1	Panacea domain-containing protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
prx	comR	negative effect
comR	comX/sigX/comX2/sigX2	positive effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comR	comX/sigX/comX1/sigX1	positive effect
comS	comX/sigX/comX1/sigX1	positive effect
clpP	comX/sigX/comX1/sigX1	negative effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comS	comX/sigX/comX2/sigX2	positive effect
clpP	comX/sigX/comX2/sigX2	negative effect

Sequence

Protein

• Length: 60 a.a.
• Molecular weight: 6771.70 Da
• Isoelectric Point: 3.9944

>NTDB_id=550 SPYM3_RS06310 WP_011054726.1 1230304..1230486(-) (prx) [Streptococcus pyogenes MGAS315]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK

Nucleotide

• Length: 183 bp

>NTDB_id=550 SPYM3_RS06310 WP_011054726.1 1230304..1230486(-) (prx) [Streptococcus pyogenes MGAS315]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA

Domains

No domain identified.

3D structure

• AlphaFold DB: A0A0H2UVL5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
prx	Streptococcus pyogenes MGAS315	80	100	0.8
prx	Streptococcus pyogenes MGAS8232	80	100	0.8
prx	Streptococcus pyogenes MGAS315	80	100	0.8
prx	Streptococcus pyogenes MGAS315	78.333	100	0.783
prx	Streptococcus pyogenes MGAS315	73.333	100	0.733
prx	Streptococcus pyogenes MGAS315	87.805	68.333	0.6

References

• [1]: Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983]