Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYM3_RS06310 | Genome accession | NC_004070 |
| Coordinates | 1230304..1230486 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes MGAS315 | ||
| Function | Inhibit ComR activation Competence regulation |
||
Function
In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1230304..1271815 | 1230304..1230486 | within | 0 |
Gene organization within MGE regions
Location: 1230304..1271815
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM3_RS06310 (SpyM3_1203) | prx | 1230304..1230486 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| SPYM3_RS06320 (SpyM3_1204) | - | 1230832..1231407 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| SPYM3_RS06325 (SpyM3_1205) | spek | 1231883..1232662 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| SPYM3_RS06330 (SpyM3_1206) | - | 1232966..1233832 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| SPYM3_RS06335 (SpyM3_1207) | - | 1233820..1234344 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| SPYM3_RS06340 (SpyM3_1208) | - | 1234484..1235686 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| SPYM3_RS06350 (SpyM3_1209) | - | 1235797..1235982 (-) | 186 | WP_011054731.1 | holin | - |
| SPYM3_RS06355 (SpyM3_1210) | - | 1235979..1236275 (-) | 297 | WP_011054732.1 | hypothetical protein | - |
| SPYM3_RS06360 (SpyM3_1211) | - | 1236286..1236897 (-) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| SPYM3_RS06365 (SpyM3_1212) | - | 1236900..1237331 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| SPYM3_RS06370 (SpyM3_1213) | - | 1237343..1239226 (-) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| SPYM3_RS06375 (SpyM3_1214) | hylP | 1239241..1240254 (-) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| SPYM3_RS06380 (SpyM3_1215) | - | 1240251..1242395 (-) | 2145 | WP_011054736.1 | phage tail spike protein | - |
| SPYM3_RS06385 (SpyM3_1216) | - | 1242392..1243108 (-) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| SPYM3_RS06390 (SpyM3_1217) | - | 1243105..1246365 (-) | 3261 | WP_011054738.1 | tape measure protein | - |
| SPYM3_RS06395 (SpyM3_1218) | - | 1246355..1246936 (-) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| SPYM3_RS06400 (SpyM3_1219) | - | 1246940..1247374 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| SPYM3_RS06405 (SpyM3_1220) | - | 1247413..1247898 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| SPYM3_RS06410 (SpyM3_1221) | - | 1247898..1248296 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| SPYM3_RS06415 (SpyM3_1222) | - | 1248293..1248649 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| SPYM3_RS06420 (SpyM3_1223) | - | 1248649..1248981 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| SPYM3_RS06425 (SpyM3_1224) | - | 1248971..1249387 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| SPYM3_RS06430 (SpyM3_1225) | - | 1249441..1250259 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| SPYM3_RS06435 (SpyM3_1226) | - | 1250263..1250877 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| SPYM3_RS06440 (SpyM3_1227) | - | 1251003..1251269 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| SPYM3_RS06445 (SpyM3_1228) | - | 1251331..1251570 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| SPYM3_RS06450 (SpyM3_1229) | - | 1251542..1253020 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| SPYM3_RS06455 (SpyM3_1230) | - | 1253025..1254527 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| SPYM3_RS06460 (SpyM3_1231) | - | 1254541..1255832 (-) | 1292 | Protein_1245 | PBSX family phage terminase large subunit | - |
| SPYM3_RS06465 (SpyM3_1232) | - | 1255835..1256308 (-) | 474 | WP_011054747.1 | hypothetical protein | - |
| SPYM3_RS06470 (SpyM3_1233) | - | 1256359..1256736 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| SPYM3_RS09960 (SpyM3_1234) | - | 1256797..1257273 (-) | 477 | WP_174132581.1 | GNAT family N-acetyltransferase | - |
| SPYM3_RS06480 (SpyM3_1235) | - | 1257189..1257866 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| SPYM3_RS06485 (SpyM3_1236) | - | 1257845..1258363 (-) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| SPYM3_RS09965 (SpyM3_1237) | - | 1258444..1258701 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| SPYM3_RS06490 (SpyM3_1240) | - | 1259340..1259780 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPYM3_RS10365 | - | 1260054..1260224 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| SPYM3_RS06495 (SpyM3_1241) | - | 1260221..1260727 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| SPYM3_RS10370 (SpyM3_1242) | - | 1260724..1260894 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| SPYM3_RS06500 (SpyM3_1243) | - | 1260891..1261295 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| SPYM3_RS06505 (SpyM3_1244) | - | 1261305..1261574 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| SPYM3_RS06510 (SpyM3_1245) | - | 1261571..1261855 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| SPYM3_RS06515 (SpyM3_1246) | - | 1261849..1262100 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| SPYM3_RS06520 (SpyM3_1247) | - | 1262097..1262453 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| SPYM3_RS06525 (SpyM3_1248) | - | 1262450..1262890 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPYM3_RS06530 | - | 1262890..1263093 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| SPYM3_RS06535 (SpyM3_1249) | ssbA | 1263099..1263518 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| SPYM3_RS06540 (SpyM3_1250) | - | 1263511..1264185 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| SPYM3_RS06545 (SpyM3_1251) | - | 1264186..1264668 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SPYM3_RS06550 (SpyM3_1252) | - | 1264690..1264944 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| SPYM3_RS10250 | - | 1264955..1265095 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| SPYM3_RS06555 (SpyM3_1253) | - | 1265092..1265325 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| SPYM3_RS06560 (SpyM3_1254) | - | 1265306..1265719 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| SPYM3_RS06565 (SpyM3_1255) | - | 1265841..1266098 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| SPYM3_RS06570 (SpyM3_1256) | - | 1266192..1266377 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| SPYM3_RS06575 (SpyM3_1257) | - | 1266406..1266663 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| SPYM3_RS09985 (SpyM3_1258) | - | 1266909..1267076 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| SPYM3_RS06585 (SpyM3_1259) | - | 1267152..1267352 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| SPYM3_RS10375 (SpyM3_1260) | - | 1267349..1267498 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| SPYM3_RS06590 (SpyM3_1261) | - | 1267531..1268259 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| SPYM3_RS06595 (SpyM3_1262) | - | 1268270..1268461 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| SPYM3_RS06600 (SpyM3_1263) | - | 1269257..1269616 (+) | 360 | WP_011054768.1 | helix-turn-helix domain-containing protein | - |
| SPYM3_RS06605 (SpyM3_1264) | - | 1269630..1270010 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYM3_RS06610 (SpyM3_1265) | - | 1270021..1270542 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| SPYM3_RS06615 (SpyM3_1266) | - | 1270718..1271815 (+) | 1098 | WP_015967409.1 | site-specific integrase | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| prx | comR | negative effect |
| comR | comX/sigX/comX2/sigX2 | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comR | comX/sigX/comX1/sigX1 | positive effect |
| comS | comX/sigX/comX1/sigX1 | positive effect |
| clpP | comX/sigX/comX1/sigX1 | negative effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comS | comX/sigX/comX2/sigX2 | positive effect |
| clpP | comX/sigX/comX2/sigX2 | negative effect |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
Multiple sequence alignment
References
| [1] | Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983] |